Recombinant Drosophila persimilis Protein wntless(wls)

Code CSB-CF451836DMB
Size Pls inquire other sizes
Source in vitro E.coli expression system

Product Details

Target Names wls
Uniprot No. B4GZN1
Species Drosophila persimilis (Fruit fly)
Expression Region 36-562
Target Protein Sequence APVPAGHTNVLGSLCRENHARQNDTSFFLYSRGEGSCTQVTREEVEQDSMKLANQIVHVF QMPLPRDSRVLDYSRWQQNLIGVLQVEFGYDSSSELREPPKELQLTIDMRLAYRNKGDPD HAWKLYAHGVEHRYLDCVAAHIGSSETLYTCDMIPLFELGALHHSFYLLNLRFPLDTPKQ MNLQFGHMHDLTLTAIHQNGGFTHVWLMLKTLLFPFVVGIMVWFWRRVHLLQRSPALLEY MLLYLGGALTFLNLPLEYLSLTIEMPYMLLLSDIRQGIFYAMLLSFWLVFAGEHMLIQDS HNKSTIRSRYWKHLSAVVVGCISLFVFDISERGVQLRNPFYSIWTTPLGAKVAMSFILLA GVSAAVYFLFLCYMISKVFKNIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLLCAAL TVTGFIMGQMAEGQWKWNDDVEIQLTSAFLTGVYGMWNIYIFALLILYAPSHKQWPTMHH SDETTQSNENIVASAASEEIEFSNLPSDSNPSEISSLTSFTRKVAFE
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.
Still Have Questions? Start a Chat

Target Data

Function A segment polarity gene required for wingless (wg)-dependent patterning processes, acting in both wg-sending cells and wg-target cells. In non-neuronal cells wls directs wg secretion. The wls traffic loop encompasses the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi, and involves clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps35 and Vps26). In neuronal cells (the larval motorneuron NMJ), the wg signal moves across the synapse via the release of wls-containing exosome-like vesicles. Postsynaptic wls is required for the trafficking of fz2 through the fz2-interacting protein Grip (By similarity).
Subcellular Location Cell junction, synapse, presynaptic cell membrane, Multi-pass membrane protein, Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein, Endosome membrane, Multi-pass membrane protein, Golgi apparatus membrane, Multi-pass membrane protein
Protein Families Wntless family
Database Links

KEGG: dpe:Dper_GL22839

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.