Recombinant Human Killer cell immunoglobulin-like receptor 2DS2 (KIR2DS2)

Code CSB-CF012360HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
KIR2DS2; CD158J; NKAT5; Killer cell immunoglobulin-like receptor 2DS2; CD158 antigen-like family member J; MHC class I NK cell receptor; NK receptor 183 ActI; Natural killer-associated transcript 5; NKAT-5; p58 natural killer cell receptor clone CL-49; p58 NK receptor CL-49; CD antigen CD158j
Species
Homo sapiens (Human)
Expression Region
22-304
Target Protein Sequence
HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Gene References into Functions
  1. Genotypes missing these two inhibitory KIR-HLA combinations in addition to missing activating KIRs 2DS2 and 2DS3 were more common in Vogt-Koyanagi-Harada disease (OR = 1.90, P = 0.002). PMID: 27490240
  2. KIR2DS2/HLA-C1 may correlate with Hashimoto thyroiditis in a Chinese population. PMID: 27042744
  3. Loss of KIR2DS2 gene is associated with breast cancer. PMID: 27631728
  4. association between KIR2DS2 and the response to methotrexate (MTX), moreover, the combination KIR2DL2+/KIR2DS2+ was more frequent in responders to MTX (p = 0.043). PMID: 27251940
  5. this study shows that the presence of KIR2DS2 was associated with a worsening of haematopoietic stem cell transplantation from HLA-matched sibling donor for treatment of myeloid malignancies PMID: 27394130
  6. genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians PMID: 26472014
  7. this study was to look for immunogenetic determinants in the pathogenesis of FMF and find out if KIR are related to susceptibility. An activator KIR gene, KIR2DS2, was significantly more frequent in FMF patients (p=0.036). PMID: 26574972
  8. a significant increase in the frequency of KIR2DL2 (P = 0.019) as well as KIR2DS2 (P = 0.008) in patients with neuroblastoma compared with the healthy control group, was found. PMID: 26202659
  9. Single Nucleotide Polymorphism in KIR2DS2 gene is associated with Asthma and Atopic Dermatitis. PMID: 26430804
  10. genetic polymorphism is associated with chronic hepatitis C and levels of viremia in Poland PMID: 25636579
  11. KIR2DL2 and KIR2DS2 genotype is associated with protection against primary biliary cirrhosis in Han population. PMID: 25575065
  12. CD4(+) CD28(-) cells exhibited increased KIR2DS2, reduced KIR2DL3 and increased DAP12 expression in HD-ESRD compared with NDD-CKD patients. PMID: 25484131
  13. Authors showed a significant increased correlation between KIR2DL2/DS2, type 2 diabetes and HLA-C1C1 genotype in the type 2 diabetes patients infected with human herpesvirus 8. PMID: 24122895
  14. NK cells with KIR2DS2 immunogenotype have a functional activation advantage to efficiently kill glioblastoma and prolong animal survival. PMID: 25381437
  15. There is an association of the KIR2DS gene, especially KIR2DS2, with psoriatic arthritis. PMID: 24185760
  16. Activating killer cell immunoglobulin-like receptor 2DS2 binds to HLA-A*11. PMID: 24550293
  17. Analysis of this large cohort from Uganda in the context of other African populations reveals variations in KIR and HLA-C1 and C2 that are consistent with migrations within Africa and potential selection pressures on these genes. PMID: 23974321
  18. Data indicate that increased frequency of the activating receptor KIR2DS1 and a reduced frequency of the KIR-ligand combination KIR2DS2/2DL2 absent/C1 present were significantly associated with chronic myeloid leukemia (CML). PMID: 23380384
  19. presence of KIR2DS2 is associated with rheumatoid arthritis. PMID: 22960345
  20. Our data revealed a unique contribution of activating KIRs (KIR2DS4, KIR2DS2, or KIR3DS1), in addition to NKG2C, in the expansion of human natural killer cells. PMID: 23325834
  21. in response to HCT therapy, the activating receptors are also enhanced by a process that increases the number of unmethylated sites present on KIR2DS2/4 promoters. PMID: 22939905
  22. The frequency of the combination of HLA-C1 allele group with KIR2DS2 was significantly higher in severe dry eye disease patients. PMID: 22509813
  23. individuals possessing KIR2DL2 and/or KIR2DS2 (and, in most cases, also KIR2DL1) gene but no HLA-C C2 ligand may respond better to treatment and survive longer than people bearing other genotypes. PMID: 22836042
  24. KIR2DS2/KIR2DL2 and HLA-C genotype of rheumatoid arthritis patients may provide predictive information for response to anti-TNF-alpha therapy. PMID: 21373785
  25. In a comparison of healthy controls and a tightly defined cohort of adult ITP patients, the KIR2DS2/KIR2DL2 genotype was found to be associated with ITP independently of FCGR3a-158 polymorphisms. PMID: 22024796
  26. The CMV seropositivity of donors was not associated with activating KIR expression, and donor null expression in those with the KIR2DS2 or KIR2DS4 genotype was not predictive for CMV reactivation in the recipient. PMID: 21596150
  27. This study showed a significantly lower frequency of KIR2DS2 among chronic HCV carriers compared with controls in a Korean population PMID: 22065905
  28. KIR2DS2*005 encodes a molecule expressed on the surface of natural killer- and T-lymphocytes. PMID: 21593779
  29. predisposition to systemic lupus erythematosus was associated with GTGT deletion at the SLC11A1 3'UTR, presence of KIR2DS2 +/KIR2DS5 +/KIR3DS1 + profile, increased number of stimulatory KIR genes and European and Amerindian ancestries PMID: 21233146
  30. indicated nonspecific stimulation of natural killers, probably mediated by an increase in serum concentration of heat shock protein with a molecular weight of 70 kDa PMID: 21165439
  31. Observational study of gene-disease association. (HuGE Navigator) PMID: 20878400
  32. an evolutionary trend toward reducing the avidity of the activating C1- and C2-specific receptors is exempllified by KIR2DS2, an activating C1-specific receptor that has lost all detectable avidity for HLA class I. PMID: 20802150
  33. Observational study of gene-disease association. (HuGE Navigator) PMID: 20528243
  34. Observational study of gene-disease association. (HuGE Navigator) PMID: 20580654
  35. Observational study of gene-disease association. (HuGE Navigator) PMID: 20600442
  36. Observational study of gene-disease association. (HuGE Navigator) PMID: 20643584
  37. Observational study of genotype prevalence. (HuGE Navigator) PMID: 20650299
  38. Observational study of gene-disease association. (HuGE Navigator) PMID: 20652381
  39. Observational study of genotype prevalence. (HuGE Navigator) PMID: 20670355
  40. Observational study of gene-disease association. (HuGE Navigator) PMID: 20137308
  41. Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 20356536
  42. Observational study of gene-disease association. (HuGE Navigator) PMID: 20371502
  43. Observational study of gene-disease association. (HuGE Navigator) PMID: 20426625
  44. Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 20483367
  45. Observational study of gene-disease association. (HuGE Navigator) PMID: 20492596
  46. Observational study of gene-disease association. (HuGE Navigator) PMID: 20519398
  47. Single nucleotide polymorphism in KIR2DS2 gene is associated with posttransplantation non-Hodgkin lymphoma. PMID: 20207982
  48. Observational study of gene-disease association. (HuGE Navigator) PMID: 19683555
  49. Observational study of gene-disease association. (HuGE Navigator) PMID: 19968064
  50. Observational study of gene-disease association. (HuGE Navigator) PMID: 20082482

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily
Database Links

HGNC: 6334

OMIM: 604953

KEGG: hsa:100132285

UniGene: Hs.512572

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1