Recombinant Human Killer cell immunoglobulin-like receptor 2DS2(KIR2DS2)

Code CSB-CF012360HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P43631
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA
Source in vitro E.coli expression system
Gene Names KIR2DS2
Protein Names Recommended name: Killer cell immunoglobulin-like receptor 2DS2 Alternative name(s): CD158 antigen-like family member J MHC class I NK cell receptor NK receptor 183 ActI Natural killer-associated transcript 5 Short name= NKAT-5 p58 natural
Expression Region 22-304
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Database Links

HGNC: 6334

OMIM: 604953

KEGG: hsa:100132285

UniGene: Hs.512572

Pathway Antigen processing and presentation
Natural killer cell mediated cytotoxicity

Related Products

KIR2DS2 Antibodies

KIR2DS2 Antibodies for Homo sapiens (Human)

KIR2DS2 Antibodies for Human

KIR2DS2 Proteins

KIR2DS2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.