Recombinant Human Tyrosine-protein kinase STYK1 (STYK1)

Code CSB-CF753734HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
STYK1; NOK; Tyrosine-protein kinase STYK1; Novel oncogene with kinase domain; Protein PK-unique; Serine/threonine/tyrosine kinase 1
Species
Homo sapiens (Human)
Expression Region
1-422
Target Protein Sequence
MGMTRMLLECSLSDKLCVIQEKQYEVIIVPTLLVTIFLILLGVILWLFIREQRTQQQRSG PQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQI CSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQDFLGRIQFHQYLGKHKNLVQL EGCCTEKLPLYMVLEDVAQGDLLSFLWTCRRDVMTMDGLLYDLTEKQVYHIGKQVLLALE FLQEKHLFHGDVAARNILMQSDLTAKLCGLGLAYEVYTRGAISSTQTIPLKWLAPERLLL RPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIMKRPSSCTHTMYSIMK SCWRWREADRPSPRELRLRLEAAIKTADDEAVLQVPELVVPELYAAVAGIRVESLFYNYS ML
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probable tyrosine protein-kinase, which has strong transforming capabilities on a variety of cell lines. When overexpressed, it can also induce tumor cell invasion as well as metastasis in distant organs. May act by activating both MAP kinase and phosphatidylinositol 3'-kinases (PI3K) pathways.
Gene References into Functions
  1. Overexpression of STYK1 was significantly associated with increased cell proliferation, migratory capability, and invasive capability in vitro, as well as increased volume of tumor, weight of tumor, and number of pulmonary metastasesin hepatocellular carcinoma. PMID: 27628214
  2. STYK1 plays an important role in glioma development and progression. PMID: 27983928
  3. Findings show that serine-threonine-tyrosine kinase 1 (NOK) mediates glycolysis and nuclear pyruvate dehydrogenase complex (PDC) associated histone acetylation. PMID: 28410146
  4. Survival analysis reveals that STYK1 level is an independent prognostic factor for nasopharyngeal carcinoma patients. Our results indicate that STYK1 is a promising therapeutic target in nasopharyngeal carcinoma PMID: 28720063
  5. Thus, our results reveal a novel tumorigenic function of NOK to mediate the genesis and remodeling of blood and lymphatic vessels during tumor progression. PMID: 27444381
  6. High STYK1 expression is associated with intrahepatic cholangiocarcinoma. PMID: 27542675
  7. increased STYK1 protein expression correlates with disease progression and metastasis and may serve as a predictor of poor survival in CRC. PMID: 25884558
  8. The data indicates that both P203 and V395 residues on NOK are important for NOK mediated mitogenic signaling. PMID: 25961552
  9. NOK expression increased in renal cell carcinoma and was significantly correlated with TNM stage, Fuhrman grade, poor overall survival, poor disease-free survival, metastasis, and proliferation. PMID: 27012048
  10. STYK1/NOK is dramatically upregulated in colorectal cancer tissues and could be used as a tumor marker. Furthermore, the high expression of STYK1/NOK is significantly associated with tumor size. PMID: 25169509
  11. These results suggest that STYK1 is a novel drug resistance factor and could be a predictor of the therapeutic response in acute leukemia. PMID: 25190507
  12. Our results indicate that NOK expression is of clinical significance and can serve as a prognostic biomarker in non-small cell lung cancer. PMID: 24894011
  13. SuRTK106/NOK/STYK1 was first identified, classified and shown to have predicted pseudokinase domain. PMID: 12471243
  14. The expression levels of NOK, p-Akt(Thr308) and p-GSK-3beta(Ser9) were positively correlated in cancerous and non-cancerous breast cell lines. PMID: 23010592
  15. Taken together, NOK has a strong tendency towards forming aggregates, which may have physiological implications and provide the first evidence that this novel receptor kinase is colocalised with EGFR in endosomes to participate in a post-internalisation step of EGFR. PMID: 22516751
  16. cloning and characterization; mapped to chromosome 12p13; widely expressed in human tissues PMID: 12841579
  17. NOK mRNA was highly expressed even at the early clinical stages of the cancer. These results suggest that NOK mRNA might be a new tool to support the diagnosis of lung cancers, irrespective of the clinical stages. PMID: 17298854
  18. The regulation of STYK1/NOK is achieved independent of ERalpha and suggests further investigation to the relevance of this kinase in breast cancer progression. PMID: 17415682
  19. results indicate that STYK1/NOK mRNA is widely expressed in the patients with acute leukemia and suggest that inhibition of this molecule could potentially serve as a novel therapeutic target PMID: 19409952
  20. Overexpression of the potential kinase serine/ threonine/tyrosine kinase 1 (STYK 1) in castration-resistant prostate cancer. PMID: 19664042

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein.
Protein Families
Protein kinase superfamily, Tyr protein kinase family
Tissue Specificity
Widely expressed. Highly expressed in brain, placenta and prostate. Expressed in tumor cells such as hepatoma cells L-02, cervix carcinoma cells HeLa, ovary cancer cells Ho8910 and chronic myelogenous leukemia cells K-562, but not in other tumor cells suc
Database Links

HGNC: 18889

OMIM: 611433

KEGG: hsa:55359

STRING: 9606.ENSP00000075503

UniGene: Hs.24979

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1