Recombinant Mouse Galactoside 2-alpha-L-fucosyltransferase 1(Fut1)

Code CSB-CF009073MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O09160
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MWTPSRRQLCLTFLLVCVLSAGSFFFHLNGGNFFRNGLTLSVLCSDYHLLKSPVAMVCLPHPLQTSNGSPSCPEQSSSLSGTWTITPGGRFGNQMGQYATLLALAQLNGRQAFIQPEMHAALAPVFRISLPVLDPEVDSLTPWQHLVLHDWMSEEYSHLEDPFLKLSGFPCSWTFFHHLREQIRREFTLHNHLREGAQYLLSGLRIGPASPAHTFVGVHVRRGDYLEVMPNRWKGVVGDRAYLQQAMDWFRARHKDPIFVVTSNGMKWCLENIDTSHGDVVFAGNGQEGTPGKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFRPEAAFLPEWVGINADLSPLQAQFDPWKPDSLFRLV
Source in vitro E.coli expression system
Gene Names Fut1
Protein Names Recommended name: Galactoside 2-alpha-L-fucosyltransferase 1 EC= 2.4.1.69 Alternative name(s): Alpha(1,2)FT 1 Fucosyltransferase 1 GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1
Expression Region 1-376
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Gal-beta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway.
Subcellular Location Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 11 family
Tissue Specificity In the adult, highly expressed in pancreas, testis and epididymis and to a lesser extent in thymus, lung, stomach, small intestine, colon, spleen and uterus. Not expressed in brain, heart, skeletal muscle, kidney, liver and bone marrow.
Database Links

STRING: 10090.ENSMUSP00000008605

UniGene: Mm.491495

Related Products

Fut1 Proteins

Fut1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.