Recombinant Mouse Gap junction delta-3 protein(Gjd3)

Code CSB-CF838702MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Gjd3
Uniprot No. Q91YD1
Alternative Names Gjd3; Gja11; Gjc1; Gap junction delta-3 protein; Connexin-30.2; Cx30.2; Gap junction alpha-11 protein; Gap junction chi-1 protein
Species Mus musculus (Mouse)
Expression Region 1-278
Target Protein Sequence MGEWAFLGSLLDAVQLQSPLVGRLWLVIMLIFRILVLATVGGAVFEDEQEEFVCNTLQPG CRQTCYDRAFPVSHYRFWLFHILLLSAPPVLFVIYSMHQASKEAGGAQLAPPCARGRAEA PCSPCALRARRARRCYLLSVALRLLAELAFLGGQALLYGFRVDPHYACAGPPCPHTVDCF VSRPTEKTVFVVFYFAVGLLSALLSVAELGHLLWKGRQRAKLLPPPPPSPSLPSQRGDPD PFGPPAYAHRSPAGDSEGEGGSGHSKASLATVRQDLAI
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Gene References into Functions
  1. results suggest that intercellular coupling mediated by Cx30.2 intercellular channels may synchronize the functional activity of ECs and SMCs of vascular cells, as well as of epithelial ductal cells after birth. PMID: 30100173
  2. Significant reduction of Cx30.2 mRNA was found in islets preparations incubated for 24h in 22mM as compared with 3.3mM glucose. PMID: 23831630
  3. The data of this stiudy provided evidence that coupling of RG A1 cells to displaced amacrine cells is mediated by Cx30.2 and that the extent of this coupling is modulated by protein kinase C. PMID: 20537217
  4. The electrical properties of homo- and hetero-typic junctions involving mCx30.2 may contribute to slow propagation velocity in nodal tissues and directional asymmetry of excitation spread in the AV nodal region. PMID: 15879306
  5. Cx30.2 contributes to the slowdown of impulse propagation in the atrioventricular node and limits the maximum number of beats conducted from atria to ventricles PMID: 16571663
  6. Hemichannels formed of mCx30.2 and hCx31.9 may slow propagation of excitation in the sinoatrial and atrioventricular nodes by shortening the space constant and depolarizing the excitable membrane [connexin 30.2] PMID: 16772377
  7. In the hippocampus, co-immunofluorescence analyses revealed beta-galactosidase/Cx30.2 expression in GABAergic inhibitory interneurons such as parvalbumin- and somatostatin-positive basket, axo-axonic, bistratified or oriens lacunosum-moleculare cells. PMID: 17942321
  8. Cx30.2 and Cx40 act as counterparts in the AV-node and His-bundle, decreasing or increasing, respectively, electrical coupling and conduction velocity in these areas. PMID: 19248787
  9. A distal enhancer for the connexin 30.2 (Cx30.2, also known as Gjd3) gene required for normal atrioventricular (AV) delay in mice, is necessary and sufficient to direct expression to the developing AV conduction system, which is alos dependent on Gata4. PMID: 19592579

Show More

Hide All

Subcellular Location Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families Connexin family, Delta-type subfamily
Database Links

KEGG: mmu:353155

STRING: 10090.ENSMUSP00000055246

UniGene: Mm.453253

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1