Recombinant Mouse Integral membrane protein GPR137B(Gpr137b)

Code CSB-CF807386MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8BNQ3
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MEAPPWEPVRNDSLPPTLSPAVPPYVKLGLTAVYTVFYALLFVFIYAQLWLVLRYRHKRL SYQSVFLFLCLFWASLRTVLFSFYFRDFVAANSFSPFVFWLLYCFPVCLQFFTLTLMNLY FTQVIFKAKSKYSPELLKYRLPLYLASLFISLVFLLVNLTCAVLVKTGDWDRKVIVSVRV AINDTLFVLCAISLSICLYKISKMSLANIYLESKGSSVCQVTAIGVTVILLYTSRACYNL FILSFSQIKNVHSFDYDWYNVSDQADLKSQLGDAGYVVFGVVLFVWELLPTTLVVYFFRV RNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDDDLAWNIAPQGLQGSFAPDYCDWGQQ NNSFLAQAGTLHQDSTLDPDKASQG
Source in vitro E.coli expression system
Gene Names Gpr137b
Protein Names Recommended name: Integral membrane protein GPR137B Alternative name(s): Transmembrane 7 superfamily member 1 protein
Expression Region 1-385
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Lysosome membrane, Multi-pass membrane protein
Protein Families GPR137 family
Database Links

KEGG: mmu:83924

UniGene: Mm.379269

Related Products

Gpr137b Proteins

Gpr137b Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.