Recombinant Pig Enteropeptidase(TMPRSS15)

Code CSB-CF018824PI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P98074
Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Sequence LGKSHEARGTMKITSGVTYNPNLQDKLSVDFKVLAFDIQQMIGEIFQSSNLKNEYKNSRVLQFENGSVIVIFDLLFAQWVSDENIKEELIQGIEANKSSQLVAFHIDVNSIDITESL
Source in vitro E.coli expression system
Gene Names TMPRSS15
Protein Names Recommended name: Enteropeptidase EC= 3.4.21.9 Alternative name(s): Enterokinase Serine protease 7 Transmembrane protease serine 15 Cleaved into the following 3 chains: 1. Enteropeptidase non-catalytic mini chain 2. Enteropeptidase non-cata
Expression Region 52-117
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Peptidase S1 family
Database Links

KEGG: ssc:397152

STRING: 9823.ENSSSCP00000012801

UniGene: Ssc.298

Related Products

TMPRSS15 Proteins

TMPRSS15 Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.