Recombinant Rat 5-hydroxytryptamine receptor 2A (Htr2a)

Code CSB-CF010887RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Htr2a; Htr2; 5-hydroxytryptamine receptor 2A; 5-HT-2; 5-HT-2A; Serotonin receptor 2A
Species
Rattus norvegicus (Rat)
Expression Region
1-471
Target Protein Sequence
MEILCEDNISLSSIPNSLMQLGDGPRLYHNDFNSRDANTSEASNWTIDAENRTNLSCEGY LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAIWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLASFSFLPQSSLSSEKLFQRSIH REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPALAYK SSQLQVGQKKNSQEDAEQTVDDCSMVTLGKQQSEENCTDNIETVNEKVSCV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores. Affects neural activity, perception, cognition and mood. Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction.
Gene References into Functions
  1. Our results indicate that chlorpromazine ameliorates visceral hypersensitivity and that the 5-HT2A receptor is a potential therapeutic target for treating abdominal pain and discomfort in irritable bowel syndrome. PMID: 28750135
  2. Bilateral diaphragm electromyography (EMG) was performed in vagal-intact and spontaneously breathing rats before and after intravenous administration of the 5-HT2A receptor antagonist Ketanserin (1mg/kg). Intravenous ketanserin significantly attenuated ipsilateral diaphragm EMG activity in C2 spinal cord hemisection animals but had no impact on diaphragm output in uninjured animals. PMID: 28711602
  3. Together, these data provide evidence of a direct effect of 5-HT on adipose cells, where 5-HT suppresses lipolysis and glucose uptake, which could contribute to altered systemic lipid- and glucose metabolism. PMID: 27109474
  4. that 5HT2A receptors mediate 3,4-methylenedioxymethamphetamine-induced PGE2 signaling and subsequent increases in glutamate PMID: 26670377
  5. Study aimed at further characterizing the effects of prenatal immune activation on 5-HT2A and mGlu2/3 receptor function in male and female rat offspring PMID: 26051401
  6. This study showed that Serotonin-2C and -2a receptor co-expression on cells in the rat medial prefrontal cortex. PMID: 25818050
  7. Studied the effect of a 5-HT2A receptor antagonist on pain-related behavior, endogenous 5-hydroxytryptamine (5-HT) plasma levels, and expression of 5-HT2A receptors in dorsal root ganglia (DRGs) in a rat lumbar disc herniation model. PMID: 25584948
  8. Following nicotine withdrawal, 5-HT2A receptor transcript level is reduced in the ventral tegmental area. PMID: 26031442
  9. rats were trained in an operant conditioning task while receiving fluoxetine), tianeptine (serotonin reuptake enhancer, 10mg/kg), buspirone, risperidone (5-HT2A antagonist, 1mg/kg), ondansetron (5-HT3 antagonist, 2mg/kg) or vehicle PMID: 24949809
  10. 5-HT can directly activate PAFs through 5-HT2A receptor and promote fibroblasts phenotypic alterations and adventitia fibrosis depending on the signaling of the TGF-beta1/Smad3 pathway. PMID: 25185755
  11. Findings reveal the "therapeutic" activation of serotonin 5-HT2A in the inhibition of the compulsive drinking behaviour in HD rats. PMID: 25155310
  12. our findings demonstrate that low levels of serotonin, interacting with 5-HT2A receptor, are able to activate proliferative signals in the thyroid epithelial cells. PMID: 24997405
  13. findings do not support the hypothesis that changes in 5-HT2A R function are a vital mechanism through which uncontrollable stress contributes to stress-related pathologies such as depression; it remains to be determined whether effects of stress on 5HT2A R binding depend on nature of the stressor or on characteristics of the rat strain PMID: 24823545
  14. The results indicate that 5-HT1A and 5-HT2A receptors in the dorsomedial nucleus of the hypothalamus play a phasic inhibitory role upon escape expression, as previously reported in the dorsal periaqueductal gray matter PMID: 23787365
  15. Stress and d-amphetamine withdrawal affect prefrontal 5-HT2AR mRNA expression to a similar degree. PMID: 24287377
  16. The data presented here suggest that the mechanisms mediating the cannabinoid-induced upregulation of 5-HT2A receptors would be brain-region specific. PMID: 23721787
  17. Endogenously released 5-HT inhibits A and C fiber-evoked synaptic transmission in the rat spinal cord by the facilitation of GABA/glycine and 5-HT release via 5-HT(2A) and 5-HT(3) receptors. PMID: 23399761
  18. Together our data suggest that 5-HT(2A) receptors activation is involved in the regulation of distribution of cytoskeleton in the dendritic spines. PMID: 23684573
  19. 5-HT2A receptor antagonists can reduce the activation of hepatic stellate cells in liver cirrhotic. PMID: 23362947
  20. This study demonistrated taht that during their adult lives the animals with hippocampal lesions exhibit different alterations, mainly at behavioural level and in the gene expression of 5-HT(2A) receptor. PMID: 23291154
  21. 5-HT decreasing apoptosis through 5-HT2A receptor is involved, at least in part, in pulmonary artery remolding. PMID: 23301505
  22. sustained activation of CB2 receptors, which up-regulates 5-HT2A receptor signaling, enhances GRK5 expression; the phosphorylation of CB2 receptors; and the beta-arrestin 2/ERK interactions. PMID: 23592773
  23. Results suggest that ligands acting on HTR2A likely modulate cocaine-induced locomotion via a common mechanism to influence dopamine-dependent circuitry. PMID: 23201361
  24. 5-HT2A receptors seem to have a pathophysiological role in the middle cerebral artery smooth muscle. PMID: 22659115
  25. the increased contractile responses to 5-HT in partial bladder outlet obstruction rat bladder may be partly caused by 5-HT(2A) receptor upregulation in the detrusor smooth muscles. PMID: 23344575
  26. Activation of 5-HT2A receptors upregulates the function of the neuronal K-Cl cotransporter KCC2. PMID: 23248270
  27. Secondhand smoke exposure induces transcriptional upregulation of the 5-HT(2A), ET(B) and ET(A) receptors in rat bronchial smooth muscle cells. PMID: 22952915
  28. Data suggest that chronic activation of cannabinoid receptor 2 in neurons of the prefrontal cortex enhances expression of serotonin 2A receptor (5-HT2A) and dopamine D2 receptor (D2 receptor) and formation of 5-HT2A/D2 receptor complexes. PMID: 22791651
  29. The enhanced striatal 5HT(2A) receptors modulate the ventilatory response to hypoxia. Immediate glucose resuscitation was found to ameliorate the receptor and transporter alterations. PMID: 21683764
  30. 5-HT2R mediates maintaining and modulatory effect of the nociceptive response. PMID: 21186576
  31. This study demonstrated that a complete transection at the T10 spinal level the serotonin 2A receptor mrna was up-regulation. PMID: 22056918
  32. Region-specific changes in 5-HT(2A) receptor mRNA expression occur in limbic system and associated areas following chronic D-amphetamine treatment. PMID: 21420940
  33. Upregulation of serotonin 2A receptor underlies the development of serotonin denervation supersensitivity in spinal motoneurons following spinal injury, implicating their involvement in the pathogenesis of subsequent spasticity development. PMID: 21211552
  34. The 5-HT2A receptor plays a complex role in the amygdaloid complex, since it can regulate amygdaloid activity by acting on different neuronal populations. PMID: 21126512
  35. The mRNA and protein expressions of 5-HT2A receptor increased in excessive fatigue rats and restraint stress rats. PMID: 21600121
  36. A pronociceptive role is supported following 5-HT2 receptor activation, most likely through modulation of 5-HT2A receptor activity on spinal nociceptive transmission under normal conditions. PMID: 21276431
  37. Effects of 5-HT1 and 5-HT2 serotonin receptors on anxiety- and depression-like behavior in female rats PMID: 21598629
  38. Data describe the changes in 5HT(2A) receptors and its transporter in the cerebral cortex of hypoxic neonatal rats and hypoxic rats resuscitated with glucose, oxygen, and epinephrine. PMID: 20857344
  39. 5-HT receptors and Ca(2)+ transporting/chaperone ER proteins may participate in the activating process of hepatic stellate cells PMID: 21245988
  40. While normal rats can compensate for loss of 5-HT(2) receptor activity, after severe spinal cord injury rats require constitutive activity in these 5-HT(2) receptors to produce locomotion. PMID: 20861436
  41. Changes of exploratory activity in a novel environment induced by social isolation are associated with a decrease in mRNA expression of the Htr2a serotonin receptor genes in the midbrain and in the striatum. PMID: 20662937
  42. Serotonin 5-HT(2)-receptor blockade, though, does not appear to contribute to the therapeutic effect of the antipsychotic clozapine. PMID: 20811878
  43. Data suggest that pyridoxine in combination with insulin and A. marmelose has a role in regulation of insulin synthesis and release, through hippocampal 5-HT2A and insulin receptor function. PMID: 20868513
  44. Hypoxic stress increased the number of total 5HT(2A) receptors along with an up-regulation of 5HT(2A) receptor gene in cerebellum PMID: 20471502
  45. Serotonin 2 receptor modulation of hyperthermia, corticosterone, and hippocampal serotonin depletions following serial exposure to chronic stress and methamphetamine. PMID: 19879056
  46. results indicate that the upregulation of 5-HT2A receptors at least partly underlies the 5-HT denervation supersensitivity of spinal motoneurons after a complete spinal transection PMID: 20085755
  47. Modulation of gamma rhythms is implemented through distinct subpopulations of FSi expressing 5-HT1ARs and 5-HT2ARs. PMID: 20147548
  48. The effect of lysergic acid diethylamide on prepulse inhibition (PPI) is mediated by the 5-HT(2A) receptor, whereas activation of the 5-HT(2A) receptor does not appear to contribute to the effect of lisuride on PPI. PMID: 19937319
  49. However, activation of 5HT2 receptors diminishes the subsequent inspiratory-related excitatory neurotransmission to CVNs that is recruited during the recovery from hypoxia likely exerting an inhibitory action on inspiratory-related purinergic signaling. PMID: 19772899
  50. effect of thyroidectomy on the expression of mRNA in the frontal cortex PMID: 12058363

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon. Cytoplasmic vesicle. Membrane, caveola. Cell projection, dendrite. Cell junction, synapse, presynapse.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in adult intestine, especially in mucosal epithelium, longitudinal and circular layers of muscularis externa and myenteric plexuses. Highly expressed in Paneth cells, and detected at lower levels in enterocytes (at protein level). Detected in bra
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1