Recombinant Rat Protein lifeguard 1(Grina)

Code CSB-CF761298RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6P6R0
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MSHEKSFLVSGDSYPPPNPGYPVGPQAPMPPYVQPPYPGAPYPQAAFQPSPYGQPGYPHG PGPYPQGGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPPPFQDPGSPQHGNYQEEGPPSYY DNQDFPSVNWDKSIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFVRANVWTYYVS YAIFFISLIVLSCCGDFRRKHPWNLVALSILTISLSYMVGMIASFYNTEAVIMAVGITTA VCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFTCF LAVDTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE
Source in vitro E.coli expression system
Gene Names Grina
Protein Names Recommended name: Protein lifeguard 1 Alternative name(s): Glutamate [NMDA] receptor-associated protein 1 NMDA receptor glutamate-binding subunit
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Potential apoptotic regulator.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families BI1 family, LFG subfamily
Database Links

KEGG: rno:266668

STRING: 10116.ENSRNOP00000056356

UniGene: Rn.5898

Related Products

Grina Proteins

Grina Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.