Recombinant Rat Rhomboid domain-containing protein 1(Rhbdd1)

Code CSB-CF709278RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q4V8F3
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MQRRTRGIDTGLLLLLSQVFHIGINNIPPVTLATLAVNVWFFLNPWKPLYHSCISVEKCY QQNDWQRLLLSPVHHGDDWHLYFNMVSMLWKGVKLEKRLGSRWFAYIIATFSLLTGVVYL LLQFASAELMNQPDFKRNCAVGFSGVLFALKVLSNHYCPGGFVNILGFPVPNRFACWAEL AAIHFCTPGTSFAGHLAGILVGLMYTQGPLKKIMDACAGIFISNAGSSGQQYHFNNAGPS GYQNRYTDGRPVNYEATYRNYDIYTAGLSEEEQLERALRASIWDRGNTRNGPIPYGFRLP PEEEMRRQRLHRFDGQ
Source in vitro E.coli expression system
Gene Names Rhbdd1
Protein Names Recommended name: Rhomboid domain-containing protein 1 EC= 3.4.21.-
Expression Region 1-316
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Intramembrane-cleaving serine protease that cleaves single transmembrane or multi-pass membrane proteins in the hydrophobic plane of the membrane, luminal loops and juxtamembrane regions. Involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded membrane proteins. Required for the degradation process of some specific misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Functions in BIK, MPZ, PKD1, PTCRA, RHO, STEAP3 and TRAC processing. Involved in the regulation of exosomal secretion; inhibits the TSAP6-mediated secretion pathway. Involved in the regulation of apoptosis; modulates BIK-mediated apoptotic activity. Also plays a role in the regulation of spermatogenesis; inhibits apoptotic activity in spermatogonia (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein, Mitochondrion
Protein Families Peptidase S54 family
Tissue Specificity Expressed in intestine, lung, brain, kidney, epididymis and testis.
Database Links

KEGG: rno:316557

STRING: 10116.ENSRNOP00000019898

UniGene: Rn.55926

Related Products

Rhbdd1 Proteins

Rhbdd1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.