Recombinant Salmonella typhimurium Tyrosine-protein kinase wzc(wzc)

Code CSB-CF880695SXB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9F7B1
Storage Buffer Tris-based buffer,50% glycerol
Species Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Sequence MTEKAKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADAL VQIEQNAGNSLVQDINSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLF GAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDKRYQLVSDGGFSAQGVVGQPLN KDGVTMRVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQ IREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVD LPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGR VTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLK PKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDS VKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKT FVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAI ANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHAGT TLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
Source in vitro E.coli expression system
Gene Names wzc
Protein Names Recommended name: Tyrosine-protein kinase wzc EC= 2.7.10.-
Expression Region 1-719
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the extracellular polysaccharide colanic acid synthesis. The autophosphorylated form is inactive. Probably involved in the export of colanic acid from the cell to medium (By similarity).
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Etk/wzc family
Database Links

KEGG: stm:STM2116

STRING: 99287.STM2116

Related Products

wzc Proteins

wzc Proteins for Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.