Recombinant Tetraodon nigroviridis XK-related protein 4(xkr4)

Code CSB-CF674361TCA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q49LS9
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)
Sequence MAAKSDGVLKMKKSDVAFTPLQNSEHSGSVQGLHPGAQPDSAGAGDADFANGESRCCGGG GSHSTCLRLSREQQKYTVWDCLWIVAAVAVYVADVGSDVWLSVDYYLEEDYWWFGLTLFF VVLGSFSVQLFSFRWFVHDFSTEDSAEAAADGSHMDGNKLLSGSASHGDVTAQHHPATPQ RQASTASRNTTTNSTASTGLGPRGPKRPAYYTFCVWGSQSVIHILQLGQIWRYIHTIYLG VQSRQSAETERWRYYWRMVYEFADVSMLHLLATFLESAPQLVLQLCIIIQTHKLLAVQGC RLFIYYLLILAENAALSALWYLYRSPLATDAFAVPALCVIFSSFLTGVVFMLMYYAFFHP NGPRFGRSMSGHGLNLDPTAQFSTLPSEVATNSLRSNRGATATLERDAGKYSERDGCMPV FQVRPTVPSTPSSRAPRLEETVIKIDLCRNRYPAWERHVLDRSIRKAILAVDCSLTPPRL QYKDDALVQERLEYETTL
Source in vitro E.coli expression system
Gene Names xkr4
Protein Names Recommended name: XK-related protein 4
Expression Region 1-498
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families XK family
Database Links

KEGG: tng:GSTEN00033649G001

STRING: 99883.ENSTNIP00000021301

Related Products

xkr4 Proteins

xkr4 Proteins for Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.