Recombinant Tetraodon nigroviridis XK-related protein 4(xkr4)

Code CSB-CF674361TCA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names xkr4
Uniprot No. Q49LS9
Alternative Names xkr4; xrg4; GSTENG00033649001; XK-related protein 4
Species Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)
Expression Region 1-498
Target Protein Sequence MAAKSDGVLKMKKSDVAFTPLQNSEHSGSVQGLHPGAQPDSAGAGDADFANGESRCCGGG GSHSTCLRLSREQQKYTVWDCLWIVAAVAVYVADVGSDVWLSVDYYLEEDYWWFGLTLFF VVLGSFSVQLFSFRWFVHDFSTEDSAEAAADGSHMDGNKLLSGSASHGDVTAQHHPATPQ RQASTASRNTTTNSTASTGLGPRGPKRPAYYTFCVWGSQSVIHILQLGQIWRYIHTIYLG VQSRQSAETERWRYYWRMVYEFADVSMLHLLATFLESAPQLVLQLCIIIQTHKLLAVQGC RLFIYYLLILAENAALSALWYLYRSPLATDAFAVPALCVIFSSFLTGVVFMLMYYAFFHP NGPRFGRSMSGHGLNLDPTAQFSTLPSEVATNSLRSNRGATATLERDAGKYSERDGCMPV FQVRPTVPSTPSSRAPRLEETVIKIDLCRNRYPAWERHVLDRSIRKAILAVDCSLTPPRL QYKDDALVQERLEYETTL
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Phospholipid scramblase that promotes phosphatidylserine exposure on apoptotic cell surface. Phosphatidylserine is a specific marker only present at the surface of apoptotic cells and acts as a specific signal for engulfment.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families XK family
Database Links

KEGG: tng:GSTEN00033649G001

STRING: 99883.ENSTNIP00000021301

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1