Recombinant Type II secretion system protein F(outF)

Code CSB-CF341249EGI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P31704
Storage Buffer Tris-based buffer,50% glycerol
Species Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi)
Sequence MALFQYQALNAQGKKSQGMQEADSARHARQLLREKGLVPVKIEEQRGEAAPRSGFSLSFG RSHRIASDLALLTRQLATLVAALPLEEALDAVAKQSEKPKLSALMAAVRAKVVEGHSLAE AMGNFPGSFERLYCAMVAAGEASGHLDAVLNRLADYTEQRHEMRSRIQQAMIYPCVLTLV AISVVSILLSAVVPKVVEQFIHMKQALPLSTRLLMSASDAVRTYGPWVVLLLVLAIMGFR VLLRQEKHRLVFHRRLLFLPVVGRVARGLNTARYARTLSILNSSAVPLLQAMRISGDVLT NDYARFRLGQATDAVREGVTLHKALEQTALFPPMMRHMIASERRRARRHVNPRGDNQDRE FSAQMTLVLGLFEPLLVVSMAGIVLFIVLAILQPILQLNTLMSM
Source in vitro E.coli expression system
Gene Names outF
Protein Names Recommended name: Type II secretion system protein F Short name= T2SS protein F Alternative name(s): General secretion pathway protein F Pectic enzymes secretion protein OutF
Expression Region 1-404
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in a type II secretion system (T2SS, formerly general secretion pathway, GSP) for the export of proteins (By similarity). Required for the translocation of the multiple pectic enzymes.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families GSP F family

Related Products

outF Proteins

outF Proteins for Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.