Recombinant UPF0259 membrane protein WIGBR3650(WIGBR3650)

Code CSB-CF807690WAN
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8D2I9
Storage Buffer Tris-based buffer,50% glycerol
Species Wigglesworthia glossinidia brevipalpis
Sequence MSISIKNLILDAWNFFVNQIINIIFFSTISAIISSLINYIFLPNRDELFTLANLISDFNG SINNINYLFQKMSIEQKYILFKLSLSNHLSSLVGNAFLFSNIITMINTICDKKRFFNIFN NIILSSSLIPKFLTLIFLISFLTQCGMALMLIPGIIVLIFLSFSPILITKKNISITDSIK ISVNITFKNIKTVAPIIFLWLLIKLIILVISSQISINGFLSSVKIFFYLINNIITVYIII YMYRLYLLSKIKKNKYL
Source in vitro E.coli expression system
Gene Names WIGBR3650
Protein Names Recommended name: UPF0259 membrane protein WIGBR3650
Expression Region 1-257
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0259 family
Database Links

KEGG: wbr:yciC

STRING: 36870.WGLp365

Related Products

WIGBR3650 Proteins

WIGBR3650 Proteins for Wigglesworthia glossinidia brevipalpis

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.