Recombinant Vibrio vulnificus Electron transport complex protein RnfA(rnfA)

Code CSB-CF752229VCQ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7MM81
Storage Buffer Tris-based buffer,50% glycerol
Species Vibrio vulnificus (strain YJ016)
Sequence MTEYILLLIGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTMASVCAYLVE SYILEPLHIEYLRTMSFILVIAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTNCAVLGVA LLNINENHSFVESIIYGFGAAVGFSLVLILFASMRERISAADVPAPFKGASIAMITAGLM SLAFMGFTGLVK
Source in vitro E.coli expression system
Gene Names VV1192
Protein Names Recommended name: Electron transport complex protein RnfA
Expression Region 1-192
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of a membrane complex involved in electron transport.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families NqrDE/RnfAE family
Database Links

KEGG: vvy:VV1192

Related Products

VV1192 Proteins

VV1192 Proteins for Vibrio vulnificus (strain YJ016)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.