Recombinant Vitis vinifera CASP-like protein 2B1(GSVIVT00013502001)

Code CSB-CF418561VFQ
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names GSVIVT00013502001
Uniprot No. A7R385
Alternative Names
GSVIVT00013502001; CASP-like protein 2B1; VvCASPL2B1
Species Vitis vinifera (Grape)
Expression Region 1-202
Target Protein Sequence MSYLGVGVSPGNVPVYHGTNLKVVDRRVRLAELVLRCVICGLGILAAVLVGTDTQVKVIF TIQKKAKFTDMKALVFLVIANGIAAAYSLIQGLRCVVSMVRGSVLFSKPLAWAIFSGDQV IAYLTLAAVAAAAQSSVFGEFGQPELQWMKICNMYGKFCNQVGEGIVSAVGVSLSMVILS GISAFSLFRLYGGNKGTSGGRW
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length full length protein
Tag Info N-terminal 10xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families Casparian strip membrane proteins (CASP) family
Database Links

KEGG: vvi:100854015

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1