Recombinant Xenopus laevis Protein wntless homolog A(wls-a)

Code CSB-CF727735XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q66IZ4
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xenopus laevis (African clawed frog)
Sequence FLVGGLIAPKPTSYVNPVAMKCVDVRKNHRSSKWLMPWGTEPCKSIQSFDEAANRMIEAN DIVFAAHIPNSQFEMSPWFQFMLVVLQLDIAFKLNNYIEENSMVTLDVSVAYRDDLKEEW KELASSVEQRKLNCILPVEKTLANEGRHYDCDVIPLMELGSVSHKYYLFNIRLPVNERKK ANIGIGEIRDLHVVSIFQNGGFTMVWFAMKTFLTPSIIIIMIWYWRRITMMTRSPVLLEK VIFALGFSMTFINIPVEWFSIGYDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQTE RNRISVYWKQVGPIAFGSCCLFIFDMCERGVQLKNPFYSIWTTDVGAEIAMAFIIVAGIC ACLYFLFLCFMVYQVFRNISGKQSNLPAMTKARRLHYEGLIFRFKFLMIITLACAALTIV FFITTQITEGNWKLGDLSIELNSAFFTGVYGMWNLYVFALMFLYAPSHKHYGDGQSNDGA GMSSGEELQLTTTITHIDGPTEVYRLAGKEAQE
Source in vitro E.coli expression system
Gene Names wls-a
Protein Names Recommended name: Protein wntless homolog A Alternative name(s): Integral membrane protein GPR177-A
Expression Region 29-541
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for a subset of Wnt-dependent developmental processes, in particular, eye and pronephros development. Regulates the secretion of wnt4, which is required for eye development (By similarity).
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein, Cytoplasmic vesicle membrane, Multi-pass membrane protein
Protein Families Wntless family
Database Links

KEGG: xla:447540

UniGene: Xl.11487

Related Products

wls-a Proteins

wls-a Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.