Recombinant Yarrowia lipolytica pH-response regulator protein palH/RIM21(RIM21)

Code CSB-CF892268YAP
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9UVF6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Sequence MHSDAPTPVANELSEVSHLAEGDNASFSAGNFTVLQLPSDPSHCIDYAIPAGTLVIVDPN NPDNNRTVKLQAPAVFRPQCALGGTRAPAPRPEESFPDWSEYQKYHHNDRRDPFYGSVTP IAYTIAASTVTAWMLLIILFLSRKPSPLFQKIAVLITAVSLTVFLAQATDTLESQYNEGY QNAYELRHKIMGGWAFRILQVITCVITWLARLQVVIRLFDVPKINTRLAVVGSTLIFTNA TIWACLNLIPPWSQYVRNAKSVLPVFGALCSLLLEVFYLVVVVIYSISKRKYAYSRTSIV MAAISWLAMILPMVFIVFDIAHYWIAGWSDFIRWTADAAASVVVWEWTNVIVYQERREQR QSVLGRQVYRDEILDFKGDNGGGTVGGGRTKYPSRMEEDDVPFRSSPNDHHFTSNIPTSA GEGQSFQFFKRARLPMYSRKIWKIARGESAASNNTHYEHAIIEEEEEESIERNRRTPTVQ ENGEEDDEETYDEENDQYSQDNHSSVHSFESSRPSQHPVPSSGGTRAVGHTHFPLPGQSE GAHTTSPAAAAAAAEPEPEPVAGPSGGAAAHGDSDDDSDNSDDSSLASFTVIQQTGFSVD NQGVPEYDADSAPPTFEPIPGFHRQDYSDAKG
Source in vitro E.coli expression system
Gene Names RIM21
Protein Names Recommended name: pH-response regulator protein palH/RIM21
Expression Region 1-632
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families PalH/RIM21 family
Database Links

KEGG: yli:YALI0F12397g

STRING: 4952.XP_505329.1

Related Products

RIM21 Proteins

RIM21 Proteins for Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.