Recombinant Human Interferon lambda-3(IFNL3)

In Stock
Code CSB-AP004471HU
Product Type Interleukin
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q8IZI9
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4
Alias Interleukin-28B; IL-28B; Cytokine Zcyto22; Interferon Lambda-3; IFN-Lambda-3; Interferon Lambda-4; IFN-Lambda-4; Interleukin-28C; IL-28C; IL28B; IFNL3; IFNL4; IL28C; ZCYTO22
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to binding IL10RB used funtional ELISA is less than 10 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Research Area Immunology
Source Mammalian cell
Gene Names IFNL3
Expression Region 22-196aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 20.67 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets
Subcellular Location Secreted
Protein Families Lambda interferon family
Database Links

HGNC: 18365

OMIM: 607402

KEGG: hsa:282617

STRING: 9606.ENSP00000409000

UniGene: Hs.406744

Pathway Jak-STAT signaling pathway

Related Products

IFNL3 Antibodies

IFNL3 Antibodies for Human

IFNL3 Antibodies for Homo sapiens (Human)

IFNL3 Proteins

IFNL3 Proteins for Homo sapiens (Human)

IFNL3 ELISA Kit

IFNL3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.