Recombinant Human Interferon lambda-3(IFNL3) (Active)

In Stock
Code CSB-AP004471HU
Size US$3267Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to binding IL10RB used funtional ELISA is less than 10 ug/ml.
Target Names IFNL3
Uniprot No. Q8IZI9
Research Area Immunology
Alternative Names Cytokine ZCYTO22; IFN-lambda-3; IFN-lambda-4; IL-28B; IL-28C; IL28B; IL28B_HUMAN; IL28C; Interferon lambda-3; Interferon lambda-4; interleukin 28B (interferon; lambda 3); Interleukin 28C; Interleukin-28B; Interleukin-28C
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 22-196aa
Complete Sequence VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Mol. Weight 20.67 kDa
Protein Length Full Length of Mature Protein
Tag Info C-terminal 6xHis-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets
Gene References into Functions
  1. No association between IFNL3 genotype and response to peginterferon alfa-2a in HBeAg-positive or -negative chronic hepatitis B patients was found. PMID: 30016335
  2. When analyzing the frequency of occurrence of a polymorphic variant T>G [rs8099917] IL-28B gene in children with chronic hepatitis C and healthy children revealed no differences in the distribution of alleles. PMID: 30284423
  3. zinc can act as a potent and specific inhibitor of IFN-lambda3 signaling. PMID: 28513591
  4. IL28B and MxA gene genotypes were detected among 231 chronic hepatitis C (CHC) carriers, 428 subjects with hepatitis C virus spontaneous clearance and 662 CHC patients with pegylated IFN-alpha and ribavirin (pegIFN-alpha/RBV) treatment. PMID: 29271328
  5. Single nucleotide polymorphisms (SNPs) rs12979860 and rs8099917 (IL28B) and rs1800896, rs1800871, and rs1800872 (IL10) are related to treatment outcome, but previous studies clustered nonresponse and relapse patients.Frequency of rs12979860 and rs8099917 is different between relapsers and nonresponders, but similar between relapsers and responders PMID: 29888255
  6. only IL28B rs12979860-CT and TT genotypes seem to contribute to the occurrence of chronic HCV infection in the cohort of Uruguayan population studied. Considering that a trend towards a higher frequency of "good" response genotypes was observed in responder patients, we believe that IL28B rs12979860 genotyping could be a useful tool for predicting different therapies outcome, including in the DAA era. PMID: 29499724
  7. our data show a significant association between rs12979860 polymorphism and hematologic response to IFN-alpha in PV and in the combined cohort of PV and ET. These findings imply that inborn variations in the genes involved in inflammation are related to the outcome of IFN-alpha treatment in MPNs. PMID: 29369421
  8. The selected donor with a predictable and favourable IL-28B genotype will not confer a benefit on the recipient in the living donor liver transplantation setting. PMID: 29686997
  9. IL-28B polymorphisms may be useful predictive factors for chronic periodontitis (CP) and correlated to the susceptibility to CP infection. PMID: 28655358
  10. IL28B rs12979860 polymorphism does not influence the susceptibility to HIV-1 and the AIDS development in Moroccan patients, however, this polymorphism may affect the response to HAART treatment as measured by CD4+ T cell counts PMID: 29080719
  11. This is the first report on a diagnostic test for simultaneous genotyping of IFNL3, ABCB11, and RNF7 in Chronic hepatitis C (CHC) patients. Reliable and inexpensive, the assay should provide useful information for the clinical management of CHC, like identification of patients at risk of rapid disease progression or with high chances of response to classic therapy. PMID: 28860020
  12. Results showed that INF-lambda serum concentration was increased in Alzheimer's disease (AD) and mild cognitive impairment (MCI) carrying the IFNL3 T allele compared to healthy controls (HC). Anti-HSV-1 Ab titers were higher in AD and MCI individuals carrying the IRF7 AA genotype compared to HC. IFNL3 rs12979860 and IRF7 rs6598008 polymorphisms may modulate immune responses against HSV-1 via their effect on the IFN-lam... PMID: 28984602
  13. Regardless of viral genotype we found no association between IL28B genotype and the risk of vertical transmission of HCV. The IL28B genotype CC, which has been shown to be favourable in other settings, was not protective of vertical transmission of HCV. PMID: 28820758
  14. The authors concluded that in the Chinese population, HLA-A*02:01 and DRB1*11:01 might be associated with the host capacity to clear hepatitis C virus independent of IL28B, which suggests that the innate and adaptive immune responses both play an important role in the control of hepatitis C virus. PMID: 27511600
  15. In a cohort of patients affected by HCV chronic hepatitis with genotypes 1 and 4, the prevalence of interleukin 28B (IL28B) genotypes, the possible association between IL28B polymorphism and severity of liver damage, the role of IL28B CC as a predictor of outcome were investigated PMID: 27271956
  16. Fine-tuned by RETN SNPs, intrahepatic, multi-cellular resistin reinforced IFNL3 in eliminating HCV via immunomodulation to counteract pro-inflammation. PMID: 27477870
  17. Investigated the associations of IL-28B rs12979860 and TBX21 rs17250932, rs4794067 polymorphisms with the susceptibility to, and outcomes of, hepatitis C virus (HCV) infection; results showed no significant associations for rs12979860 polymorphisms with HCV clearance and sustained virological response PMID: 29399747
  18. IFNL3 rs4803217 SNP is a strong, independent and superior predictor of sustained virological response and relapse in HCV genotype 1 infected chronic hepatitis C patients treated with pegylated interferon alpha and ribavirin. PMID: 28638221
  19. IL-28B single nucleotide polymorphism rs8099917TT is the most frequent genotype in Cuban chronic hepatitis C patients and is associated with treatment outcome as well. PMID: 28058039
  20. Liver stiffness progression in patients with chronic hepatitis C virus correlated with the IL28B TT/CC and IL28B GG/TT genotypes. PMID: 28579527
  21. IL28B (rs8099917 and rs12979860) and IL10 (rs1800896) polymorphisms alone, or in combination, are good predictors of therapeutic response in hepatitis C virus-3a patients. PMID: 29340806
  22. In this study, limit of detection (LD), costs and turnaround time of these methods were compared in 350 subjects. As for IL28B rs12979860 polymorphisms, 348/350 (99.4%) samples were consistent among the five methods, while results for 2/350 (0.57%) samples were concordant by ZNAs and PCR-sequencing, and discordant by other methods PMID: 28281380
  23. Of the 1084 patients with the IL-28 genotype, 59.4% had hepatitis C virus genotype 1 (HCV-1) infection; 85.6% had the TT genotype. Patients with advanced liver fibrosis had an older age, a lower platelet count, a higher [alpha]-fetoprotein level, a higher alanine aminotransferase level, a higher incidence of diabetes, and a higher frequency of rs8099917 non-TT genotype carriage. PMID: 29517696
  24. The SNP distribution of gene IL28 with fixed prognostic value in the population of patients with chronic hepatitis C is different from the general population, and shows the need to evaluate polymorphisms prior to treatment. PMID: 29264884
  25. Polymorphisms of IFNL3 rs8099917 and IL12A rs568408 contribute to survival of HD patients, but not as independent factors. PMID: 28525983
  26. Both hepatitis C virus-specific T cell responses and IL28B rs12979860 single-nucleotide polymorphism genotype influence anti-hepatitis C virus treatment outcome in patients with chronic hepatitis C. PMID: 28440692
  27. IFNL3 SNPs are strongly associated with treatment responses in Iranian patients with chronic hepatitis C. PMID: 28703131
  28. TLR2 and IL28B polymorphisms in combination showed a role in the control of HCV viral load and different HCV disease progression. PMID: 27183918
  29. These findings indicate that serum IFNL3 levels at baseline are higher in acute hepatitis C patients regardless of the rs8099917 polymorphism, and primary hepatitis C virus infection triggers the production of IFNL3. PMID: 29040985
  30. The association between IFNL3/4 genotypes with elevated HCV VL observed in HCV g6-infected individuals may have implications for the progression of liver disease in Southeast Asian countries where this viral genotype predominates and therefore warrants further studies. PMID: 29022122
  31. In summary, the current study did not find a significant association between IL28B rs12979860 polymorphism and hepatocarcinogenesis. PMID: 27083168
  32. Interferon lambda polymorphisms influence regulatory pathways of cellular response to interferon and affect body iron balance in chronic hepatitis C virus infection. PMID: 27125837
  33. IL-28B rs12979860 SNP could be used as an independent predictor for treatment response among HCV patients. PMID: 28502145
  34. In hemodialysis patients, circulating IFN-lambda3 strongly correlates with anti-HBs antibody production after HBV vaccination and infection. IFNL3 rs8099917 polymorphisms seem to be associated with IFN-lambda3 plasma levels in hemodialysis subjects. PMID: 27595449
  35. Results demonstrated genetic variations of IL-28B might impact liver function recovery after transplantation by influencing peripheral platelet counts and reducing liver inflammation, but weak association with transplant etiologies. PMID: 29095252
  36. The results obtained suggest that both studied IL28B gene SNPs (single nucleotide polymorphisms), as well as the IL10 gene rs1800872 SNP are associated with predisposition to tick-borne encephalitis in Russian population. PMID: 27068548
  37. IL-28B genotyping may be useful for directing patients towards lower cost therapies, and rationing use of costly direct antivirals for use in those individuals showing genetic risk. PMID: 28877177
  38. the IFNL3 rs 12979860 CC genotype may be negatively associated with hepatic steatosis in Asian chronic hepatitis C patients. PMID: 28797039
  39. IL-28B rs12979860 genotype was significantly related to severe necroinflammatory activity (NIA) grade of chronic hepatitis C patients. PMID: 28704535
  40. Data show that the genotype distributions of IFNL3 and IFNL4 variants (rs4803217, rs368234815, rs117648444, and rs12979860) were in Hardy-Weinberg equilibrium. PMID: 28394349
  41. In summary, the data suggested that the protective effect attributed to the rs12979860 single nucleotide polymorphism minor T allele could be mediated, at least in part, by eliciting robust cytomegalovirus-specific T-cell responses. PMID: 27591738
  42. The data confirm our new IFN-lambda3 binding assay can be used to quantify IFN-lambda receptor surface expression on a variety of cell types and reflects IFN-lambda3 responsiveness. PMID: 28274837
  43. In Taiwan, chronic hepatitis C (CHC) patients have a lower frequency of favorable IL28B TT genotype than healthy controls. Among patients with CHC, the frequency of TT genotype is higher in HCV genotype 2 patients than in HCV genotype 1 patients. In addition, CHC patients with TT genotype, particularly females, have a lower likelihood of advanced fibrosis. PMID: 27751759
  44. IFNL3 SNPs genotyped have shown no association with ribavirin treatment in hepatitis C patients with genotype 3. PMID: 27498543
  45. in influenza A/H3N2 virus infection, IL-28 (rs8099917) genotypes GG and TG were associated with reduced risk of influenza like illness (ILI) symptoms while genotype TT was associated with increased risk of ILI symptom PMID: 27155288
  46. monocytes from carriers of an IL-28B T/T genotype display a reduced ability to stimulate NK cell activity PMID: 27583440
  47. alterations in IL28B SNP genotype may occur after living donor liver transplantation, leading to modifications in the host genome or donor proteome by HCV. PMID: 27275739
  48. Results show that detection of SNPs in IL28B combined with increased IP-10 levels increase predictability of sustained virological Response in patients treated with pegylated interferon 2alpha a plus ribavirin. PMID: 26470765
  49. In patients infected with HCV-3 [hepatitis-C virus genotype-3], IFNlambda3 [interferon lambda-3] rs12979860, SNP[ single nucleotide polymorphisms ] has less impact on SVR [sustained virologic response ]. PMID: 27353984
  50. the association of amino acid substitutions in the HCV core protein and the IFNL3 and IFNL4 polymorphisms with the severity of liver disease, particularly in hepatocellular carcinoma development PMID: 27035616
  51. IL28B and OAS polymorphisms are associated with different clinical outcomes in chronic hepatitis B children treated with interferon. PMID: 27895405
  52. There is no significant correlation between IL28B polymorphism and treatment response to IFNalpha. PMID: 28214980
  53. unfavorable genotypes of IL28B gene rs12979860 and rs8099917 SNPs have no influence on the risk of progression to the end stage of liver disease in the Iranian population. In addition, there was no relationship between genotypes and serum level of IL28 with response to combination therapy. PMID: 28214926
  54. this study shows that the IL28B gene polymorphism and serum levels play a role in the pathogenesis of Hashimoto's thyroiditis in Turkey PMID: 27617784
  55. this study shows that the IL28B gene polymorphism may influence glucose homeostasis in Type 2 diabetes patients PMID: 27664841
  56. Results identified three SNPs (S320F, H245Y, and H77Y) as highly deleterious in KIR2DL3 and nine SNPs (R157Q, H156Y, S63L, R157 W, F179 V, H128R, T101 M, R180C and F176I) in case of IFNL3, in coding region only with high conservation ranks highlighting the functional SNPs on phenotypic variability and disease susceptibility on HCV clearance candidate genes. PMID: 27461217
  57. In hemodialysis patients, the IFNL3 polymorphisms do not affect development of antibodies to HBV surface antigen in response to HBV infection or vaccination, but might be involved in the resolution of HCV infection. PMID: 26658164
  58. Elevated on-treatment IFN-gamma concentration was significantly associated with treatment failure among interleukin-28B rs8099917TT carriers and those patients failed to achieve rapid virologic response. PMID: 26965318
  59. Population Polymorphism of IFNL3 and IFNL4 Genes of Type 3 Interferon Associated with Spontaneous Clearance of Hepatitis C Virus in Representatives of Caucasian and Mongoloid Races PMID: 27492404
  60. study confirms the role of IL28B as a determinant of baseline viremia, but both rs8099917 and rs12979860 polymorphisms should be determined to better assess clinical outcomes, treatment response and the progression of liver fibrosis. PMID: 27603672
  61. The IL13 rs20541 T allele and IL28B rs8099917 GG genotype are negative predictors of survival in patients on renal replacement therapy, while the IL28B rs12979860 TT genotype increases the risk of death only in patients negative for HBV or HCV infection. PMID: 26039912
  62. In this study, there was association of the three isolated polymorphisms (rs8099917, rs12979860 and rs368234815) with both clinical outcome and response to treatment with PEG-IFN and RBV in chronic hepatitis C. PMID: 26973228
  63. The frequency of colonic Treg cells in hepatitis C virus-infected patients had a strong association with the IL-28B genotype and may have a significant impact on hepatitis C virus clearance. PMID: 27544760
  64. In treatment-naive chronic hepatitis C patients treated with pegylated interferon and ribavirin, a polymorphism upstream CC at the site rs12979860 of IL-28B is associated with increased sustained virologic response and effectively predicts treatment outcome. PMID: 27525598
  65. findings support a model in which IFNL3 mRNA translation efficiency, governed by allele-specific mRNA structures, modulates clearance of hepatitis C virus infection PMID: 26531896
  66. SNP rs4803217, located in the 3' untranslated region (UTR) of IFNL3, has also been proposed as a causal variant for HCV clearance PMID: 26186989
  67. IFNL3 genotype is associated with differential induction of IFNL3 in primary human hepatocytes PMID: 26109548
  68. study conducted to determine the association of IL-28B rs12980275, rs12979860, and rs8099917 gene polymorphism(s) with the response (including relapse) following dual pegIFN and ribavirin therapy in genotype 4 hepatitis C Egyptian patients; SNPs at IL-28/60 and IL-28/75 are possible predictors of relapse in patients receiving dual treatment PMID: 26280154
  69. Steatosis severity was independently associated with IL28B rs12979860 in large cohort of patients with genotype 1 Chronic hepatitis C. PMID: 26259026
  70. Vitamin D related (VDR rs2228570 and CYP2R1 rs10741657) and IL28B rs12979860 genes polymorphisms accurately assure sustained viral response in naive CHC G4 patients treated with low cost standard therapy. PMID: 26911666
  71. the rs8099917 polymorphism was found strongly associated with virological response to therapy in Turkish patients infected with HCV genotype 1. We suggest determining IL28B gene polymorphism of patients with HCV genotype 1 before onset of treatment. PMID: 25857516
  72. The IL28B rs12979860 CC genotype was associated with SVR in hepatitis C patients receiving pegylated interferon plus ribavirin. PMID: 26269684
  73. a critical evaluation of interleukin 28B genotype as a pharmacogenetic predictor in hepatitis C patients. [meta-analysis] PMID: 25918016
  74. Interleukin-28B polymorphism could be a possible predictor of response to pegylated interferon/ribavirin therapy PMID: 26526510
  75. In participants with HCV genotype 1, unfavorable genotypes for HCV clearance near IFNL3 were associated with increased HCC risk, the adjusted odds ratio (95% CI) for rs12979860 and rs8099917 being 1.73 and 1.84, respectively. PMID: 26602024
  76. No significant association between the serum cytokine levels and the presence of the rs12979860 SNP of il-28B in symptomatic and asymptomatic subjects was observed PMID: 26609200
  77. IL28B polymorphism is associated with response to therapy in HCV Genotype 4. PMID: 27100663
  78. Data show that genotype TT (rs8099917) of the interleukin-28B (IL28B) gene might be a risk factor for elevation of the proviral load and CD8(+) T cell count. PMID: 26546777
  79. The association of IL28B gene polymorphisms with the treatment response points to the possibility of personalized medicine for the treatment of HCV infection PMID: 26614853
  80. IL28B polymorphism (rs12979860) is associated with clearance of HCV infection in Poland PMID: 25712648
  81. that IFN-lambda4 protein expression associated with the IL28B-T/T variant preactivates the Janus kinase-Stat signaling, leading to impaired HCV clearance by both IFN-alpha and IFN-lambda PMID: 26896692
  82. Combination of blood group specificity and interleukin 28B gene polymorphism is a simple and reliable predictor of sustained virologic response and dynamics of fibrosis. PMID: 27522730
  83. The IL28B single-nucleotide polymorphisms rs12979860 and rs8099917, but not TNF-alpha single-nucleotide polymorphism rs1800629, are associated with the clinical outcome of Andes virus-induced disease. PMID: 26394672
  84. AA genotype of rs12980275 was a predictive factor for SVR in HCV patients with PEG-IFN/RBV treatment, especially in HCV genotype 1/4. PMID: 25769643
  85. This study suggests that in hepatitis C virus genotype 1-infected patients, there is no relationship between IL28B rs12979860 genotype and insulin resistance or circulating levels of soluble receptor 1 of TNFalpha. PMID: 25818002
  86. Three out of the 110 SNPs were found to be associated with HCV outcome (P-values<0.03). rs11506105 in EGFR (epidermal growth factor receptor gene), and rs11881222 and rs12979860 in IL28B (interferon-lambda3 gene). PMID: 26378651
  87. A long TA repeat in the promoter region of IL28B was associated with spontaneous HCV clearance. PMID: 25735432
  88. The rate of CC allele in IL-28B rs12979860 gene was the highest in immune subjects, while it was the lowest in chronic hepatitis B patients. IL-28B rs12979860 gene polymorphisms were not effective on the clinical course of HBV infection PMID: 27058339
  89. IFNL3 SNPs were associated with virological response in patients with chronic hepatitis C. PMID: 26699619
  90. Polymorphism within the IL-28R1, but not in IL-28B, is associated with benign prostatic hyperplasia and lower urinary tract symptoms in Chinese. PMID: 26400298
  91. data on ex vivo derived liver tissue samples argue against an attenuating impact of IFNL3 rs4803217 or IFNL4 rs368234815 minor alleles on hepatic IFNL3 gene expression in vivo. PMID: 26606750
  92. The association of IL28B and APOH single nucleotide polymorphisms (SNPs) with sustained virological response and of ITPA SNPs with anemia related phenotypes. PMID: 26670100
  93. Both the favorable IL28B rs8099917 genotype and female sex were associated with the spontaneous clearance of hepatitis C virus infection in this Japanese population. PMID: 26660164
  94. analysis of PNPLA3 (rs738409) and IL28B (rs12979860) SNPs in HIV/HCV coinfected patients reveals no impact on liver disease or treatment response PMID: 26599080
  95. this study demonstrated that IL-28B single nucleotide polymorphism associte with Cognitive Decline and Dementia. PMID: 25835418
  96. The described is the association with spontaneous hepatitis C viral clearance and genetic differentiation of IL28B/IFNL4 haplotypes in populations from Mexico. PMID: 26741362
  97. In occult hepatitis B infection (OBI) donors, IL28B CC correlates with the intensity of HBV-specific T-cell responses;IL28B CC is not statistically associated with OBI or with HBV clearance PMID: 26022419
  98. The three most widely studied SNPs near the IL28B gene were associated with sustained virological response following antivirological treatment of chronic hepatitis C in hemodialysis patients. PMID: 26156685
  99. IFNL3 and IFNL4 genotyping could identify those likely to clear naturally and in whom treatment could be delayed, or help prioritize Directly-acting antivirals treatment to those less likely to respond to interferon-containing regimens. PMID: 26150150
  100. CC genotype in IL28B; had 8.547 folds higher chance to develop sustained virological response than CT and TT genotypes (P = 0.014). IL28B gene (TG and GG genotypes) was found to be 3.348 more likely not to respond to treatment than the TT genotype. PMID: 25936570

Show More

Hide All

Subcellular Location Secreted
Protein Families Lambda interferon family
Database Links

HGNC: 18365

OMIM: 607402

KEGG: hsa:282617

STRING: 9606.ENSP00000409000

UniGene: Hs.406744

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1