Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody (CSB-RA883439MA1HU), the EC50 is 2.129-2.956 ng/mL.
Alternative Names
(TR-2)(Hyperplastic polyposis protein 1)(Transmembrane protein with EGF-like and two follistatin-like domains)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
41-320aa
Target Protein Sequence
FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human TMEFF2 recombinant protein was produced in mammalian cell, where the gene sequence encoding Human TMEFF2 (41-320aa) was expressed with the C-terminal 10xHis tag. The purity of this TMEFF2 protein was greater than 95% by SDS-PAGE. The activity was validated.
TMEFF2, also known as TR-2, TPEF, HPP1, TENB2, is a member of the epidermal growth factor (EGF) family and was first isolated from human gastric fibroblasts by Uchida et al. It contains 1 EGF-like domain and 2 follistatin-like domains, and is a highly conserved transmembrane protein. TMEFF2 protein is abnormally expressed in various malignant tumors, and plays different roles in different types of tumors. TMEFF2 is closely related to the occurrence and development of various malignant tumors such as esophageal cancer, gastric cancer, colorectal cancer, gallbladder cancer, prostate cancer, bladder cancer, and endometrial cancer, suggesting that TMEFF2 has the potential to become a tumor-specific marker.