Name: Recombinant Human Tomoregulin-2 (TMEFF2), partial (Active)
Brand: CUSABIO
SKU: CSB-MP883439HU
Price: $190 USD
Availability: InStock
Rating: 4.0 (1 reviews)

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody (CSB-RA883439MA1HU), the EC50 is 2.129-2.956 ng/mL.

Target Names

TMEFF2

Uniprot No.

Q9UIK5

Research Area

other

Alternative Names

(TR-2)(Hyperplastic polyposis protein 1)(Transmembrane protein with EGF-like and two follistatin-like domains)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

41-320aa

Target Protein Sequence

FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV

Mol. Weight

32.3 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

TMEFF2 plays a multifaceted role in prostate cancer biology and neuronal survival signaling, making it a valuable target for both tumor biology studies and antibody development campaigns. This recombinant human TMEFF2 partial construct, spanning residues 41–320 with a C-terminal 10×His tag, is produced in mammalian cells to preserve native-like glycosylation critical for proper folding of its EGF-like and follistatin-like domains. Functional ELISA validation demonstrates strong binding to an anti-TMEFF2 recombinant antibody with an EC₅₀ of 2.129–2.956 ng/mL, confirming that this protein is appropriate for receptor-ligand binding assays, antibody characterization, and use as a reliable ELISA standard. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based proliferation and survival assays as well as in vivo tumor biology models requiring stringent endotoxin control.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

4.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction, ELISA standard and its raw materials

Review: I used CSB-MP883439HU product to conduct ELISA experiments with our antibody, and the linear range was 0.015259-2000ng/ml, the EC50 was 2.040-3.448 ng/ml, and the results showed high activity. The protein\'s purity and activity meet the requirements of our subsequent experiments, and we will continue to purchase!

By Anonymous

Code	CSB-MP883439HU
Abbreviation	Recombinant Human TMEFF2 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$190
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody (CSB-RA883439MA1HU), the EC₅₀ is 2.129-2.956 ng/mL.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Tomoregulin-2 (TMEFF2), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage