Recombinant Human Tomoregulin-2 (TMEFF2), partial (Active)

In Stock
Code CSB-MP883439HU
Abbreviation Recombinant Human TMEFF2 protein, partial (Active)
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody (CSB-RA883439MA1HU), the EC50 is 2.129-2.956 ng/mL.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody (CSB-RA883439MA1HU), the EC50 is 2.129-2.956 ng/mL.
Target Names
Uniprot No.
Research Area
other
Alternative Names
(TR-2)(Hyperplastic polyposis protein 1)(Transmembrane protein with EGF-like and two follistatin-like domains)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
41-320aa
Target Protein Sequence
FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV
Mol. Weight
32.3 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

TMEFF2 plays a multifaceted role in prostate cancer biology and neuronal survival signaling, making it a valuable target for both tumor biology studies and antibody development campaigns. This recombinant human TMEFF2 partial construct, spanning residues 41–320 with a C-terminal 10×His tag, is produced in mammalian cells to preserve native-like glycosylation critical for proper folding of its EGF-like and follistatin-like domains. Functional ELISA validation demonstrates strong binding to an anti-TMEFF2 recombinant antibody with an EC₅₀ of 2.129–2.956 ng/mL, confirming that this protein is appropriate for receptor-ligand binding assays, antibody characterization, and use as a reliable ELISA standard. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based proliferation and survival assays as well as in vivo tumor biology models requiring stringent endotoxin control.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
4.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction, ELISA standard and its raw materials

Review: I used CSB-MP883439HU product to conduct ELISA experiments with our antibody, and the linear range was 0.015259-2000ng/ml, the EC50 was 2.040-3.448 ng/ml, and the results showed high activity. The protein\'s purity and activity meet the requirements of our subsequent experiments, and we will continue to purchase!

By Anonymous

Target Background

Function
May be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation.
Gene References into Functions
  1. Differential TMEFF2 processing from a single transmembrane protein may be a general mechanism to modulate transmembrane protein levels and domains, dependent on the repertoire of ADAMs or TTSPs expressed by the target cell. PMID: 28762604
  2. TMEFF2 methylation is associated with clear cell renal cell carcinoma. PMID: 28128743
  3. Results suggest that TMEFF2 is a brain-enriched endogenous modulator of Abeta neurotoxicity and an enhancer of alpha-secretase processing of AbetaPP PMID: 26402097
  4. TMEFF2 regulates the non-canonical activin/BMP4 signaling, PI3K, and Ras/ERK1/2 pathways. PMID: 25573902
  5. c-Myc contributes to the epigenetic regulation of HPP1 via the dominant recruitment of HDAC3. PMID: 24919179
  6. TMEFF2 acts as a tumor suppressor in gastric cancer through direct interaction with SHP-1 and can be a potential biomarker of carcinogenesis. PMID: 24987055
  7. TMEFF2 and SARDH cooperate to modulate one-carbon metabolism and invasion of prostate cancer cells. PMID: 23824605
  8. Androgen signaling promotes eIF2alpha phosphorylation and subsequent translation of TMEFF2 via a mechanism that requires uORFs in the 5'-UTR of TMEFF2. PMID: 23405127
  9. Methylation of TMEFF2 gene is associated with colorectal neoplasia in ulcerative colitis and Crohn's colitis. PMID: 22532293
  10. Findings suggest that methylation-associated down-regulation of TMEFF2 gene may be involved in lung tumorigenesis and TMEFF2 methylation can serve as a specific blood-based biomarker for NSCLC. PMID: 22814847
  11. Several genes expressed at exceptionally high levels were identified associated with early oocyte development, TMEFF2, the Rho-GTPase-activating protein oligophrenin 1 (OPHN1) and the mitochondrial-encoded ATPase6 (ATP6). PMID: 22238370
  12. TMEFF2 can function to regulate PDGF signaling; it is hypermethylated and downregulated in glioma and several other cancers PMID: 21559523
  13. the tumor suppressor activity of TMEFF2 requires the cytoplasmic/transmembrane portion of the protein and correlates with its ability to bind to SARDH and to modulate the level of sarcosine. PMID: 21393249
  14. GDF15, HSPA2, TMEFF2, and VIM were identified as epigenetic biomarkers for Bladder cancer. PMID: 20975101
  15. Hypermethylation of HPP1 is associated with hMLH1 hypermethylation in gastric adenocarcinomas. PMID: 12384516
  16. Aberrant methylation of the HPP1 gene is a relative common early event in ulcerative colitis-associated colorectal carcinoma. PMID: 12460892
  17. inverse correlation between TMEFF2 and c-Myc expression PMID: 12729735
  18. Hypermethylation of p16, RUNX3, and HPP1 in Barreett exophagus may represent independent risk factors for the progression of Barrett esophagus to esophageal cancer. PMID: 15824739
  19. A secreted form of TMEFF2 is expressed from TMEFF2 locus and may functionally interact with full-length TMEFF2, or its binding partners, and may also influence current immune-based treatment strategies PMID: 16439095
  20. Hypermethylation of HPP1 is associated with primary adenocarcinomas of the small bowel PMID: 16619216
  21. Methylation testing of fecal DNA using a panel of epigenetic markers (methylated SFRP2, HPP1 and MGMT) may be a simple and promising non-invasive screening method for colorectal carcinoma and precancerous lesions. PMID: 17352030
  22. TMEFF2 contributes to cell proliferation in an ADAM17-dependent autocrine fashion in cells expressing this protein PMID: 17942404
  23. data provides evidence to support the role of HPP1 as a tumor suppressor gene; activation of the STAT1 pathway likely represents the principal mediator of HPP1's tumor suppressive properties PMID: 18059030
  24. Methylated PAX6- or TPEF-promoters could represent biomarkers for bladder cancer. PMID: 18070176
  25. Distinct TPEF/HPP1 (transmembrane protein containing epidermal growth factor) gene methylation patterns in gastric cancer indicate a field effect in gastric carcinogenesis. PMID: 18799374
  26. promoter of TPEF gene is frequently hpermethylated, and associated with loss of TPEF mRNA expression in esophageal squamous cell carcinoma PMID: 19040536
  27. Methylation of CLDN6, FBN2, RBP1, RBP4, TFPI2, and TMEFF2 in esophageal squamous cell carcinoma. PMID: 19288010
  28. Analysis of DNA from peripheral blood revealed that TPEF methylation was detectable in colorectal tumor patients and patients with early or pre-neoplastic lesions, but not in healthy volunteers. PMID: 15068392

Show More

Hide All

Subcellular Location
[Isoform 1]: Membrane; Single-pass type I membrane protein.; [Isoform 2]: Membrane; Single-pass type I membrane protein.; [Isoform 3]: Secreted.
Protein Families
Tomoregulin family
Tissue Specificity
Highly expressed in adult and fetal brain, spinal cord and prostate. Expressed in all brain regions except the pituitary gland, with highest levels in amygdala and corpus callosum. Expressed in the pericryptal myofibroblasts and other stromal cells of nor
Database Links

HGNC: 11867

OMIM: 605734

KEGG: hsa:23671

STRING: 9606.ENSP00000272771

UniGene: Hs.144513

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*