Product Details

Purity

≥ 95% as determined by SDS-PAGE.
≥ 90% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ mL can bind Anti-VSIG4 recombinant antibody (CSB-RA896869MA1HU), the EC50 is 51.14-68.73 ng/mL.

Target Names

VSIG4

Uniprot No.

Q9Y279

Alternative Names

(Protein Z39Ig)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

20-283aa

Target Protein Sequence

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP

Mol. Weight

30.6 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

VSIG4 functions as a complement receptor on macrophages and has emerged as a key negative regulator of T cell activation, positioning it alongside established immune checkpoint targets such as PD-L1 and TIGIT. This recombinant human VSIG4 construct covers the extracellular region (aa 20–283), encompassing both the IgV and IgC domains critical for ligand engagement, and is expressed in mammalian cells to preserve native glycosylation and conformational integrity essential for receptor-ligand interaction studies. Functional ELISA validation confirms robust binding activity, with an EC50 of 51.14–68.73 ng/mL against an anti-VSIG4 recombinant antibody, supporting use in blocking antibody screening, therapeutic antibody epitope mapping, and affinity characterization by SPR or BLI. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based immune checkpoint assays and small-molecule or biologic inhibitor screening in drug discovery workflows.

Target Background

Function

Phagocytic receptor, strong negative regulator of T-cell proliferation and IL2 production. Potent inhibitor of the alternative complement pathway convertases.

Gene References into Functions

Soluble VSIG4 levels are associated with the progression and recurrence of ovarian cancer, indicating that soluble VSIG4 may be used as a potential biomarker for predicting tumor prognosis. PMID: 28498255
VSIG4 signaling provides an anti-immune evasion mechanism that prevents the outgrowth of intracellular bacteria in macrophages PMID: 27440002
The VSIG4 upregulation by LMP1 was regulated at the transcriptional level via the NF-kB signaling axis. PMID: 28859984
VSIG4 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
we concluded that let-7g-5p inhibits epithelial-mesenchymal transition (EMT) consistent with reduction of glioma stem cell (GSC) phenotypes by targeting VSIG4 in glioblastoma. PMID: 27634309
Data indicate that rotein kinase calpha (PKCalpha) plays a role in downregulating complement receptor Ig (CRIg coded by V-set and Ig domain-containing protein 4 VSIG4) expression. PMID: 25687755
complement receptor of the immunoglobulin superfamily-L-factor H protects glomerular mesangial cells from complement-mediated injury and proliferative lesions PMID: 25114177
we identified VSIG4 as a potential diagnostic marker of severe preeclampsia. The determination of this gene may improve the prognostic assessment of severe preeclampsia. PMID: 24349325
Data indicate that massive V-set and Ig domain-containing 4 VSIG4(+) cell infiltration throughout the non-small-cell lung cancer samples. PMID: 24862966
we showed that a complement receptor of the Ig superfamily (CRIg, also known as Z39Ig), a receptor for complement fragments (C3b and iC3b), was expressed on a subset of intestinal macrophages in murine and human large intestine PMID: 21768202
These results suggest that T cells can opposite T cell hyporesponsiveness through dampening Z39Ig inhibitory signals from macrophages and thus maintain their anti-viral function in chronic hepatitis B. PMID: 20399148
hVSIG4 recombinant adenovirus-transfected DCs suppress T cell proliferation, cytokine production and activation marker expression with PMID: 19914289
Results report the identification and characterization of a Complement Receptor of the Immunoglobulin superfamily, CRIg, that binds complement fragments C3b and iC3b. PMID: 16530040
These data indicate that the macrophage Z39Ig is involved in the pathogenesis of inflammatory diseases through chemokine induction, which will promote the migration of inflammatory cells into the lesion area, and MMP-9 induction. PMID: 16882875
The specific expression of VSIG4 on resting macrophages suggests that VSIG4 may be important for the maintenance of T cell unresponsiveness in healthy tissues. PMID: 17016562
CRIg is not only a phagocytic receptor, but also a potent inhibitor of the alternative pathway convertases PMID: 17051150

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Tissue Specificity

Abundantly expressed in several fetal tissues. In adult tissues, highest expression in lung and placenta. Expressed in resting macrophages.

Database Links

HGNC: 17032

OMIM: 300353

KEGG: hsa:11326

STRING: 9606.ENSP00000363869

UniGene: Hs.8904

Code	CSB-MP896869HU
Abbreviation	Recombinant Human VSIG4 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ml can bind Anti-VSIG4 recombinant antibody (CSB-RA896869MA1HU), the EC₅₀ is 51.14-68.73 ng/mL. The purity of VSIG4 was greater than 90% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human V-set and immunoglobulin domain-containing protein 4 (VSIG4), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage