Code | CSB-MP896869HU |
Size | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
This Human VSIG4 recombinant protein was produced in Mammalian cell, where the gene sequence encoding human VSIG4 (20-283aa) was expressed with the C-terminal 10xHis tag. The purity of this VSIG4 protein was 95%. The activity has been validated. VSIG4 acts through complement receptors and phagocytosis. As an important effector system and effector amplification system in the body, the complement system can promote the phagocytosis of pathogens by macrophages by acting on the surface of pathogens, destroying the cell membranes of pathogens, and regulating the surface molecules of pathogens. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ mL can bind Anti-VSIG4 recombinant antibody (CSB-RA896869MA1HU), the EC50 is 51.14-68.73 ng/mL. |
Target Names | VSIG4 |
Uniprot No. | Q9Y279 |
Alternative Names | (Protein Z39Ig) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 20-283aa |
Target Protein Sequence | RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP |
Mol. Weight | 30.6 kDa |
Protein Length | Partial |
Tag Info |
C-terminal 10xHis-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Phagocytic receptor, strong negative regulator of T-cell proliferation and IL2 production. Potent inhibitor of the alternative complement pathway convertases.
|
Gene References into Functions |
|
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Tissue Specificity | Abundantly expressed in several fetal tissues. In adult tissues, highest expression in lung and placenta. Expressed in resting macrophages. |
Database Links |
HGNC: 17032 OMIM: 300353 KEGG: hsa:11326 STRING: 9606.ENSP00000363869 UniGene: Hs.8904 |