Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Species
Homo sapiens (Human)
Expression Region
3-377aa
Target Protein Sequence
DDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human ACTC1 was expressed with the amino acid range of 3-377. This ACTC1 protein is expected to have a theoretical molecular weight of 47.4 kDa. This ACTC1 protein is produced using baculovirus expression system. The ACTC1 coding gene included the C-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant ACTC1 protein in following stages of expression and purification.
The human actin, alpha cardiac muscle 1 (ACTC1) is a cardiac muscle-specific isoform of actin, which is a key component of the cytoskeleton and essential for muscle contraction. ACTC1 is predominantly expressed in the heart and contributes to the structural and functional integrity of cardiac muscle fibers. As a major constituent of sarcomeres, ACTC1 interacts with myosin to generate the contractile force required for cardiac muscle function. Mutations in ACTC1 are associated with various cardiac disorders, including hypertrophic and dilated cardiomyopathies. Understanding the role of ACTC1 in cardiac physiology and pathology is crucial for elucidating the molecular mechanisms underlying heart-related conditions and developing targeted therapeutic interventions.
