Recombinant Human Bcl-2-like protein 11(BCL2L11)

Code CSB-YP002615HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names BCL2L11
Uniprot No. O43521
Research Area Cancer
Alternative Names BCL2 like 11 ; B2L11_HUMAN; BAM; Bcl 2 interacting protein Bim; Bcl 2 related ovarian death agonist; Bcl-2-like protein 11; BCL2 interacting mediator of cell death ; BCL2 like 11 (apoptosis facilitator); BCL2 like protein 11 ; Bcl2-interacting mediator of cell death; Bcl2-L-11; Bcl2l11; BIM alpha6; BIM; BIM beta6; BIM beta7; BimEL; BimL; BOD
Species Homo sapiens (Human)
Source Yeast
Expression Region 1-198aa
Target Protein Sequence MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 24.2kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.
Gene References into Functions
  1. POH1 knockdown induced cell apoptosis through increased expression of p53 and Bim. PMID: 29573636
  2. BIM deletion polymorphism was associated with significantly shorter progression-free survival (PFS) and slightly shorter overall survival (OS), compared to the WT group. Moreover, patients with BIM deletion polymorphism showed significantly inferior response to EGFR TKIs. In conclusion, our analysis confirmed that lung cancer patients harboring the BIM deletion have inferior survival and TKI responses. PMID: 30213299
  3. Our findings suggest that miR-23 plays a crucial role in controlling VSMCs proliferation and apoptosis by targeting BCL2L11 PMID: 30249504
  4. FoxO3a overexpression increased the transcription and protein expression of Bcl2like protein 11 and cyclindependent kinase inhibitor 1B, and inhibited cyclin D1 transcription and expression. PMID: 29257235
  5. Data indicate that miR-34a enhanced the sensitivity to cisplatin by upregulation of c-Myc and Bim pathway. PMID: 29060932
  6. Modulation of MEK/ERK-dependent Bim and Mcl-1 degradation critically mediates sensitivity and resistance of EGFR-mutant non-small cell lung cancer (NSCLC)cells to AZD9291 and hence is an effective strategy to overcome acquired resistance to AZD9291 PMID: 28765329
  7. TMEM16A expression was found to correlate with greater tumor size, less Bim expression, and less apoptotic activity overall in head and neck squamous cell carcinomas (HNSCCs). PMID: 28899969
  8. Hypermethylation of the proapoptotic genes BCL2 L11 and TNFRSF25 is observed in pleomorphic adenoma of the salivary glands. However, this phenomenon did not impact mRNA transcription. PMID: 28941993
  9. Data suggest that regulation of pancreatic beta-cell function and survival/apoptosis involves alternative splicing modulated by key splicing regulator SRP55; SRP55-regulated alternative splicing includes modulation of function of pro-apoptotic proteins (BIM, BAX), JNK signaling, and endoplasmic reticulum stress. (SRP55 = pre-mRNA-splicing factor SRP55; BAX = apoptosis regulator BAX) PMID: 29246973
  10. Bim expression was significantly different in the four molecular subtypes of breast cancer. PMID: 28582840
  11. BIM deletion is a significant predictor of shorter PFS and OS on EGFR-TKIs. Further studies to determine its effect on response to other BIM-dependent therapeutic agents are needed, so that alternative treatment strategies may be devised. PMID: 28467813
  12. These findings indicate the importance of developing HDAC3-selective inhibitors, and their combined use with osimertinib, for treating EGFR-mutated lung cancers carrying the BIM deletion polymorphism PMID: 27986747
  13. Low BIM expression is associated with renal cell carcinoma. PMID: 27582546
  14. The decreased miR-101-3p caused elevated Bim expression by targeting its 3'-untranslated region (3'-UTR). PMID: 28518140
  15. The mitochondrial apoptotic pathway, activated by BH3-only proteins, BIM and PUMA, is essential for endoplasmic reticulum stress-induced cell death; DR5 as well as caspase-8 are not required for this process. PMID: 28409774
  16. sequestration of Bim by Mcl-1 is a mechanism of intrinsic ABT-199 resistance and supports the clinical development of ABT-199 in combination with cytarabine or daunorubicin for the treatment of AML. PMID: 27103402
  17. Knock down of VDR and BIM reduces the enhancement of cell death treated with Cytarabine (AraC) followed by the addition of Doxercalciferol together with Carnosic acid (CA). PMID: 27144333
  18. UMI-77 enhances TRAIL-induced apoptosis by unsequestering Bim and Bak, which provides a novel therapeutic strategy for the treatment of gliomas. PMID: 28337703
  19. Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design. PMID: 29149594
  20. in FOXO3-death-resistant cells no point mutations in the TP53-DBD were found-in these cells FOXO3-TP53 complexes are formed and FOXO3-binding to the BIM-promoter, but not the induction of the detoxifying protein SESN3, were prevented, which in turn increased chemo-protection in this type of high-stage-derived neuroblastoma cells PMID: 28869600
  21. At BCL2L11, the authors identify a haematopoietic enhancer hub that is inactivated by the Epstein-Barr virus repressors EBNA3A and EBNA3C through recruitment of the H3K27 methyltransferase EZH2. PMID: 27490482
  22. observations suggest that an association of a deletion polymorphism of BIM and the response to induction therapy in B-cell precursor acute lymphoblastic leukemia may be clinically minimal PMID: 28641145
  23. expression of Bim is mediated by FoxO1 and indirectly downregulated by thyroid hormone/thyroid hormone receptor, leading to chemotherapy resistance and doxorubicin-promoted metastasis of hepatoma cells. PMID: 27490929
  24. BIM is associated with favorable prognostic markers for prediction of disease-free survival and overall survival in cervical cancer. PMID: 28870908
  25. this study shows that BIM deletion polymorphisms are associated with a poor clinical response to erlotinib and represents an independent prognostic factor for patients with EGFR positive non-small-cell lung cancer PMID: 27926478
  26. The Bim deletion polymorphism was found to be associated with primary resistance to crizotinib in patients with ALK fusion-positive NSCLC. PMID: 28346673
  27. increased apoptosis resistance was associated with significantly reduced up-regulation of proapoptotic Bim in T cells from patients with primary sclerosing cholangitis. PMID: 27630216
  28. Results suggest that valproic acid (VPA) reduces paraoxonase 2 (PON2) expression in glioblastoma multiforme (GBM) cells, which in turn increases reactive oxygen species (ROS) production and induces Bim protein production that inhibits cancer progression via the PON2-Bim cascade. PMID: 28108734
  29. Little difference in Bim expression among CD20+ cells was seen between tonsil primary follicles, tonsil germinal centers, and lupus nephritis renal tissue. The frequency of Bim-positive cells among CD4+ lymphocytes was significantly lower in lupus nephritis kidneys compared to tonsil controls. PMID: 27159593
  30. Inhibition of mTORC1-mediated 4EBP1 phosphorylation leads to decreased expression of c-MYC and subsequent upregulation of the proapoptotic BCL2 family member PUMA, whereas inhibition of mTORC2 results in nuclear factor-kappaB-mediated expression of the Early Growth Response 1 (EGR1) gene, which encodes a transcription factor that binds and transactivates the proapoptotic BCL2L11 locus encoding BIM. PMID: 26917778
  31. miR-423-3p activates oncogenic and Beclin-1-dependent autophagy and promotes GC progression by reducing the expression of Bim. The newly identified miR-423-3p-Bim axis might be a potential therapeutic target in GC. PMID: 28254439
  32. activation of the PI3K pathway does not suppress activation of the ARF or BIM gene by over-expressed E2F1 PMID: 27888102
  33. have shown that Bim protein expression in CM is an independent predictor for advanced disease confirming that this pro-apoptotic BH3-only protein might be a potent biomarker and promising therapeutic target PMID: 27356803
  34. BIM deletion polymorphism does not account for intrinsic resistance to EGFR-TKI in Patients With Lung Adenocarcinoma PMID: 27077907
  35. Mechanistically, G-Rg1 promoted the phosphorylation of Akt and FoxO3a and led to the cytoplasmic translocation of FoxO3a, which in turn suppressed FoxO3a-modulated expression of proapoptotic Bim and elevated the ratio of Bcl-2 to Bax. PMID: 27522666
  36. Dnd1 facilitates apoptosis by increasing the expression of Bim via its competitive combining with miR-221 in Bim-3'UTR. PMID: 28191469
  37. patients with BIM-g had significantly shorter progression-free survival than those without BIM-gamma (median: 304 vs. 732 days; p=0.023). CONCLUSION: Expression of BIM-gamma mRNA and BIM deletion polymorphism were strongly associated. BIM-gamma overexpression may have a role in apoptosis related to EGFR-tyrosine kinase inhibitor PMID: 27807070
  38. MicroRNA-301b directly targets the expression of Bim, a well-known pro-apoptotic protein. PMID: 27352910
  39. FOXO4 has an inhibitory effect in clearcell renal carcinoma cells, at least in part through inducing apoptosis via upregulation of Bim in the mitochondria-dependent pathway. PMID: 26780985
  40. Results indicate that upregulation of miR-124 could regulate apoptosis and impaired autophagy process in the MPTP model of Parkinson's disease, thus reducing the loss of dopaminergic neurons PMID: 25976060
  41. the Bim activated by doxorubicin-induced DNA damage might directly interrupt the interaction of Bcl-xl with pro-apoptotic proteins, Bak/Bax, to activate mitochondriadriven apoptosis. PMID: 26694174
  42. the BIM deletion polymorphism enhanced the emergence of populations with complete imatinib resistance, mimicking the situation in patients. PMID: 26517680
  43. BimEL-Bax pro-apoptotic cascade is activated by cAMP signalling of Bordetella adenylate cyclase toxin through SHP-1 phosphatase in phagocytes. PMID: 26334669
  44. miR-24 was found to be up-regulated while the expression of BCL2L11 was inhibited in tumor tissues of gastric cancer PMID: 26758252
  45. The potent antitumor activity of RHL may be mediated through downregulation of Bcl-2 and cyclin D expression and upregulation of BAX and Bim expression. PMID: 26707131
  46. mRNA expression of BIM and MTOR in 57 patients with EGFR-mutant non-small-cell lung cancer. PMID: 26639561
  47. miR-24 promotes tumor growth and angiogenesis by suppressing Bim expression in a model of pancreatic carcinoma PMID: 26517093
  48. miR-181b/Bim pathway may be a novel target used to overcome the chemoresistance in breast cancer PMID: 26572075
  49. Bcl-2 dependent NB cell lines are exquisitely sensitive to ABT-199 . Treatment with ABT-199 displaces Bim from Bcl-2 in NB to activate caspase 3, confirming the restoration of mitochondrial apoptosis PMID: 26874859
  50. Fluorizoline bind to prohibitin, inducing mitochondrial apoptotic pathway through NOXA and BIM upregulation. PMID: 26497683
  51. LA provoked a down regulation of two anti-apoptotic proteins, Mcl-1 and Bcl-xL protein and a strong induction of the BH3-only protein Bim. PMID: 26063499
  52. JNK/c-Jun activation and BIM induction is a late pro-apoptotic response of glioma cells treated with alkylating anticancer drugs. PMID: 26418950
  53. analysis of the intricate network regulating Bim activity and its involvement in physiological and pathophysiological processes [review] PMID: 26405162
  54. Our findings support a potential role of forskolin in combination with current conventional agents in the treatment of MM. PMID: 26306624
  55. Review/Meta-analysis: BIM deletion polymorphism was associated with poor response in NSCLC patients who received EGFR-TKIs treatment. PMID: 26325082
  56. Low expression of pro-apoptotic Bim protein in in Waldenstrom macroglobulinemia. PMID: 25893290
  57. miR-192 directly targeted 3'-UTR of Bim gene, and inhibited its protein expression in esophageal squamous carcinoma cells, suppressing apoptosis and promoting proliferation. PMID: 26339371
  58. The current study demonstrated that the BH3-only protein, Bim, might regulate a subset of inflammatory cells in the gastric mucosa during H. pylori-mediated gastritis. PMID: 26197709
  59. The BIM deletion polymorphism did not predict clinical outcomes in patients with NSCLC. PMID: 26271547
  60. Jmjd3 regulates osteoblast apoptosis through targeting Bcl-2 expression and Bim phosphorylation. PMID: 26795455
  61. Taken together, these results show that CHAF1A contributes to the proliferation of glioblastoma cells and may be developed as a de novo drug target and prognosis biomarker of glioblastoma. PMID: 26740175
  62. BIM deletion polymorphism might be a genetic cause of intrinsic neoplasm resistance to tyrosine kinase inhibitor therapy. (Meta-analysis) PMID: 26076815
  63. Hepatitis C virus -induced ROS/JNK signalling transcriptionally activates Bim expression, which leads to Bax activation and apoptosis induction. PMID: 26296767
  64. It remains to be determined whether the BIM deletion polymorphism provides intrinsic resistance or decreased sensitivity to EGFR TKIs in EGFR-mutant NSCLC patients. PMID: 26001141
  65. BIM deletion polymorphism is associated with response to chemotherapy in cancer. PMID: 25922065
  66. Results show the hypermethylation of CBY1 and BCL2-like11 promoters proceeding from DNMT1 is a crucial component of their reduced expression, but it is not directly involved in chronic myeloid leukemia resistance to imatinib. PMID: 25389112
  67. BCL2 and BCLX phosphorylation represents a priming event in mitotic cell death that is triggered by NOXA-dependent MCL1 degradation. The MCL1 decay allows in turn BIM-dependent cell death. PMID: 25922916
  68. Taken together, these data indicate that the downregulation of Bad and Bim plays a significant role in the autophagy-induced chemoresistance of hepatocellular carcinoma cells. PMID: 24947039
  69. This paper shows that prosurvival activity of Akt can be converted into prodeath activity by embedding an Akt recognition sequence in the apoptogenic BH3 domain of human BIM. PMID: 26136077
  70. Activation of p38 and Jun kinase results in increased expression of the pro-apoptotic Bcl-2 homologs Bim and Puma, which inducibly bind and sequester Mcl-1 and Bcl-xL leading to the induction of the mitochondrial apoptosis pathway. PMID: 26043078
  71. PKM2 serves as a promising biomarker for poor prognosis of patients with HCC and its knockdown induces HCC apoptosis by stabilizing Bim. PMID: 25788265
  72. BIM deletion polymorphism may be involved in the tumorigenesis of the early-onset breast cancer among East Asians. PMID: 25909194
  73. Data indicate that Translocase of the Outer Membrane (TOM) complex components do not seem to be essential for pro-apoptotic BH3-only protein Bim insertion into the outer mitochondrial membrane (OMM). PMID: 25875815
  74. Data show that interactions of Bim protein BH3 peptides to myeloid cell leukemia sequence 1 (Mcl-1) is stronger than the complex with bcl-2-associated X protein (Bax) 19BH3 peptides. PMID: 24865469
  75. The data demonstrate a crucial role of Bim in preferentially regulating the Bak/Mcl-1 rheostat to mediate (DHA), a derivative of artemisinin-induced apoptosis in hepatocellular carcinoma cells. PMID: 25935454
  76. Studied melatonin enhancement of up-regulation of Bim expression and down-regulation of COX-2 expression in tunicamycin-treated MDA-MB-231 cells. PMID: 25711465
  77. BCL-XL up-regulation by STAT3 contributes to mutant KRAS-mediated apoptosis resistance. Such resistance can be overcome by potent BIM induction and concurrent BCL-XL antagonism PMID: 26245900
  78. Bcl-2-like 11 (BIM) is a proapoptotic member of the B-cell CLL/lymphoma 2 family of proteins 15 and has emerged as a key modulator of apoptosis triggered by EGFR-TKI. PMID: 26287412
  79. E4BP4 and BIM regulation correlated with that of RCAN1-1. A putative GRE and four EBPREs were identified within 1500bp upstream from the transcription start site of RCAN1-1 PMID: 26102033
  80. The BIM deletion polymorphism was not associated with lung cancer susceptibility. Furthermore, the BIM polymorphism is not associated with EGFR mutant lung cancer. PMID: 25384174
  81. our findings suggest that there might be a CKI-FoxO/Smad-Bim engine in which Thr32 of FoxO3 is pivotal for TGF-b-induced apoptosis, making it a potential therapeutic target for liver cancer treatment. PMID: 25503443
  82. Results indicate that Tax-induced downregulation of Bim in HTLV-1-infected T cells promotes their IL-2-independent growth, thereby supporting the persistence of HTLV-1 infection in vivo. PMID: 25175936
  83. Tax confers apoptosis resistance to HTLV-1-infected T cells by suppressing the expression of Bim and Bid. PMID: 25522269
  84. imidazole treatment induced apoptosis in HEC-1B cells. The proapoptotic effect was mediated by increased Bim expression. Moreover, imidazole upregulated the protein level of Foxo3a and induced its increased nuclear localisation. PMID: 25422052
  85. Pokemon prevents anoikis through the suppression of Bim expression, which facilitates tumor cell invasion and metastasis. PMID: 22754333
  86. MiR-491-5p-induced apoptosis in ovarian carcinoma by inhibition of both BCL-XL and EGFR leading to BIM activation. PMID: 25299770
  87. Cafestol overcomes ABT-737 resistance in Mcl-1-overexpressed renal carcinoma Caki cells through downregulation of Mcl-1 expression and upregulation of Bim expression. PMID: 25375379
  88. T. vaginalis induces mitochondria-dependent apoptosis in SiHa cells through the dissociation of Bcl-xL/Bim and Mcl-1/Bim complexes. PMID: 25343522
  89. compare membrane permeabilization by Bax activated by either cBid [cleaved Bid (p7 and p15)] or Bim and examine the role of membrane lipids in the recruitment and activation of these three Bcl-2 pro-apoptotic proteins PMID: 25714678
  90. Downregulation of miR-10b directly derepresses the expression of BCL2L11, an apoptosis inducer. PMID: 25659925
  91. BIM deletion polymorphism predicts shorter PFS to EGFR-TKIs and OS in advanced NSCLC. PMID: 25057939
  92. IL-10/Janus kinase/STAT3 signaling dysregulates Bim expression in autoimmune lymphoproliferative syndrome. PMID: 25174872
  93. Carboxylate-containing sulfide derivative 9 exhibited 16.4-fold more selectivity for disrupting Mcl-1/Bim over Bcl-xL/Bim binding. PMID: 25076060
  94. This study has identified novel mechanisms of opposing BCL2 and BIM gene regulation that control glucocorticoid-induced apoptosis in pediatric acute lymphoblastic leukemia cells in vivo PMID: 25336632
  95. BET inhibition with I-BET151 appears independent of the BRAF and NRAS mutational status of melanoma PMID: 24906137
  96. H2AX phosphorylation regulated by p38 is involved in Bim expression and apoptosis in chronic myelogenous leukemia cells induced by imatinib. PMID: 24830786
  97. MiR-192 binded to Bim 3'-UTR and negatively regulated Bim expression at the post-transcriptional level in lung adenocarcinoma cells. PMID: 24854555
  98. Data show that Bcl-2-like protein 11 (Bim) plays a functional role in bortezomib resistance in multiple myeloma cells and that targeting Bim by combining histone deacetylase inhibitors with ABT-737 overcomes bortezomib resistance. PMID: 25208888
  99. BIM deletion polymorphism is associated with non-small-cell lung cancer with epidermal growth factor receptor mutation. PMID: 24736070
  100. BIM synergized with BAK proapoptotic function as coexpression of both proteins enhanced and vice versa and decrease of BIM levels reduced cell death. PMID: 24120870

Show More

Hide All

Subcellular Location Endomembrane system, Peripheral membrane protein, Note=Associated with intracytoplasmic membranes, SUBCELLULAR LOCATION: Isoform BimEL: Mitochondrion
Protein Families Bcl-2 family
Tissue Specificity Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are widely expressed with tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis
Database Links

HGNC: 994

OMIM: 603827

KEGG: hsa:10018

STRING: 9606.ENSP00000376943

UniGene: Hs.469658

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1