Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

CDK7

Uniprot No.

P50613

Research Area

Cell Biology

Alternative Names

(39 kDa protein kinase)(p39 Mo15)(CDK-activating kinase 1)(Cell division protein kinase 7)(Serine/threonine-protein kinase 1)(TFIIH basal transcription factor complex kinase subunit)

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-346aa

Target Protein Sequence

MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

39.2 kDa

Protein Length

Full Length

Tag Info

Tag-Free

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In expressing the recombinant Human CDK7 protein, e.coli cells are transfected with a DNA expression vector that harbors the gene for the desired protein (1-346aa). The cultured cells then express the intended protein. The recombinant Human CDK7 protein is collected and purified from the cell lysate through affinity purification, achieving a purity surpassing 85%, as confirmed by SDS-PAGE.

Target Background

Function

Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.

Gene References into Functions

Study demonstrate that CDK7 activity is necessary to maintain the transcriptional program induced by STAT proteins that are activated both aberrantly by mutation and by extracellular cues in T-cell lymphomas. PMID: 28134252
these results implicate a CDK7-dependent "CTD code" that regulates chromatin marks in addition to RNA processing and pol II pausing. PMID: 28768201
Our studies have demonstrated the essential role of endogenous PRL and CDK7 in the upregulation of PRLR by E2 and provide insights for therapeutic approaches that will mitigate the transcription/expression of PRLR and its participation in breast cancer progression fueled by E2 and PRL via their cognate receptors. PMID: 28423697
MYC promotes mRNA cap methylation and protein production of Wnt/beta-catenin signaling transcripts through recruitment of cyclin-dependent kinase 7 (CDK7) and consequently RNMT to gene promoters. PMID: 27899423
High expression of MMP14 and CDK7 was independent prognostic factors for overall survival in patients with gastric cancer. PMID: 27562173
Taken together, these findings elucidated a novel mechanism of prostate cancer progression. Thus, SNHG1 might serve as a potential target for prostate cancer therapies. PMID: 28400279
Data indicate that cyclin dependent kinase 7 (CDK7) is overexpressed in gastric cancer cell lines and tissues. PMID: 27155449
Cdk7 broadly influences transcription and capping. PMID: 26257281
Study shows that triple-negative but not hormone receptor-positive breast cancer cells are exceptionally dependent on CDK7, a transcriptional cyclin-dependent kinase. PMID: 26406377
Data suggest a quantitative contribution of CDK7 to mRNA synthesis, which is critical for cellular homeostasis. PMID: 25047832
Interaction with cyclin H/cyclin-dependent kinase 7 (CCNH/CDK7) stabilizes C-terminal binding protein 2 (CtBP2) and promotes cancer cell migration PMID: 23393140
three CTD kinases, CDK7, CDK9, and BRD4, engage in cross-talk, modulating their subsequent C-terminal domain phosphorylation, and also phosphorylate TAF7 PMID: 23027873
Cdk7 thus acts through TFIIE and DSIF to establish, and through P-TEFb to relieve, barriers to elongation: incoherent feedforward that might create a window to recruit RNA-processing machinery. PMID: 23064645
glioma cells may be proliferating through a novel PI (3)-kinase-/PKC-iota/Cdk7/cdk2-mediated pathway. PMID: 22021906
Our findings suggest that the CDK7 TT genotype and the combined genetic polymorphisms of CDK7 and ESR1P325P are associated with breast cancer in Korean women. PMID: 19941161
determined the crystal structure of human CDK7 in complex with ATP at 3 A resolution PMID: 15530371
Cdk7 accomplishes dual functions in cell-cycle control and transcription not through promiscuity but through distinct, stringent modes of substrate recognition. PMID: 16327805
Different modes of CDK activation by Cdk7 at two distinct execution points in the cell cycle. PMID: 17386261
Data revealed that SF1 and CDK7 reside in the same complex and CDK inhibitor roscovitine blocked phosphorylation of SF1, and an inactive form of CDK7 repressed the phosphorylation level and the transactivation capacity of SF1. PMID: 17901130
A role of Cdk7 in regulating elongation is further suggested by enhanced histone H4 acetylation and diminished histone H4 trimethylation on lysine 36-two marks of elongation-within genes when the kinase was inhibited. PMID: 19667075

Hide All

Subcellular Location

Nucleus. Cytoplasm. Cytoplasm, perinuclear region.

Protein Families

Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily

Tissue Specificity

Ubiquitous.

Database Links

HGNC: 1778

OMIM: 601955

KEGG: hsa:1022

STRING: 9606.ENSP00000256443

UniGene: Hs.184298

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP005075HU
Abbreviation	Recombinant Human CDK7 protein
MSDS	MSDS Datasheet
Size	$422
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Cyclin-dependent kinase 7 (CDK7)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage