Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP001900HU |
| Product Type | Recombinant Protein |
| Size | US$2959 |
| Uniprot No. | P27695 |
| Relevance | Multifunctional protein that plays a central role in the cellular response to oxidative stress. The two major activities of APEX1 in DNA repair and redox regulation of transcriptional factors. Functions as a apurinic/apyrimidinic (AP) endodeoxyribonuclease in the DNA base excision repair (BER) pathway of DNA lesions induced by oxidative and alkylating agents. Initiates repair of AP sites in DNA by catalyzing hydrolytic incision of the phosphodiester backbone immediately adjacent to the damage, generating a single-strand break with 5'-deoxyribose phosphate and 3'-hydroxyl ends. Does also incise at AP sites in the DNA strand of DNA/RNA hybrids, single-stranded DNA regions of R-loop structures, and single-stranded RNA molecules. Has a 3'-5' exoribonuclease activity on mismatched deoxyribonucleotides at the 3' termini of nicked or gapped DNA molecules during short-patch BER. Possesses a DNA 3' phosphodiesterase activity capable of roving lesions (such as phosphoglycolate) blocking the 3' side of DNA strand breaks. May also play a role in the epigenetic regulation of gene expression by participating in DNA dethylation. Acts as a loading factor for POLB onto non-incised AP sites in DNA and stimulates the 5'-terminal deoxyribose 5'-phosphate (dRp) excision activity of POLB. Plays a role in the protection from granzymes-mediated cellular repair leading to cell death. Also involved in the DNA cleavage step of class switch recombination (CSR). On the other hand, APEX1 also exerts reversible nuclear redox activity to regulate DNA binding affinity and transcriptional activity of transcriptional factors by controlling the redox status of their DNA-binding domain, such as the FOS/JUN AP-1 complex after exposure to IR. Involved in calcium-dependent down-regulation of parathyroid hormone (PTH) expression by binding to negative calcium response elents (nCaREs). Together with HNRNPL or the dimer XRCC5/XRCC6, associates with nCaRE, acting as an activator of transcriptional repression. Stimulates the YBX1-mediated MDR1 promoter activity, when acetylated at Lys-6 and Lys-7, leading to drug resistance. Acts also as an endoribonuclease involved in the control of single-stranded RNA metabolism. Plays a role in regulating MYC mRNA turnover by preferentially cleaving in between UA and CA dinucleotides of the MYC coding region determinant (CRD). In association with NMD1, plays a role in the rRNA quality control process during cell cycle progression. Associates, together with YBX1, on the MDR1 promoter. Together with NPM1, associates with rRNA. Binds DNA and RNA |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | APEX nuclease ;APENApurinic-apyrimidinic endonuclease 1 ;AP endonuclease 1 ;APE-1REF-1Redox factor-1 |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | KNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL |
| Research Area | Epigenetics and Nuclear Signaling |
| Source | Yeast |
| Gene Names | APEX1 |
| Protein Names | Recommended name: DNA-(apurinic or apyrimidinic site) lyase EC= 3.1.-.- EC= 4.2.99.18 Alternative name(s): APEX nuclease Short name= APEN Apurinic-apyrimidinic endonuclease 1 Short name= AP endonuclease 1 Short |
| Expression Region | 32-318aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 34.2kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Multifunctional protein that plays a central role in the cellular response to oxidative stress. The two major activities of APEX1 in DNA repair and redox regulation of transcriptional factors. Functions as a apurinic/apyrimidinic (AP) endodeoxyribonuclease in the DNA base excision repair (BER) pathway of DNA lesions induced by oxidative and alkylating agents. Initiates repair of AP sites in DNA by catalyzing hydrolytic incision of the phosphodiester backbone immediately adjacent to the damage, generating a single-strand break with 5'-deoxyribose phosphate and 3'-hydroxyl ends. Does also incise at AP sites in the DNA strand of DNA/RNA hybrids, single-stranded DNA regions of R-loop structures, and single-stranded RNA molecules. Has a 3'-5' exoribonuclease activity on mismatched deoxyribonucleotides at the 3' termini of nicked or gapped DNA molecules during short-patch BER. Possesses a DNA 3' phosphodiesterase activity capable of removing lesions (such as phosphoglycolate) blocking the 3' side of DNA strand breaks. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation. Acts as a loading factor for POLB onto non-incised AP sites in DNA and stimulates the 5'-terminal deoxyribose 5'-phosphate (dRp) excision activity of POLB. Plays a role in the protection from granzymes-mediated cellular repair leading to cell death. Also involved in the DNA cleavage step of class switch recombination (CSR). On the other hand, APEX1 also exerts reversible nuclear redox activity to regulate DNA binding affinity and transcriptional activity of transcriptional factors by controlling the redox status of their DNA-binding domain, such as the FOS/JUN AP-1 complex after exposure to IR. Involved in calcium-dependent down-regulation of parathyroid hormone (PTH) expression by binding to negative calcium response elements (nCaREs). Together with HNRNPL or the dimer XRCC5/XRCC6, associates with nCaRE, acting as an activator of transcriptional repression. Stimulates the YBX1-mediated MDR1 promoter activity, when acetylated at Lys-6 and Lys-7, leading to drug resistance. Acts also as an endoribonuclease involved in the control of single-stranded RNA metabolism. Plays a role in regulating MYC mRNA turnover by preferentially cleaving in between UA and CA dinucleotides of the MYC coding region determinant (CRD). In association with NMD1, plays a role in the rRNA quality control process during cell cycle progression. Associates, together with YBX1, on the MDR1 promoter. Together with NPM1, associates with rRNA. Binds DNA and RNA. |
| Subcellular Location | Nucleus, Nucleus, nucleolus, Nucleus speckle, Endoplasmic reticulum, Cytoplasm, Note=Detected in the cytoplasm of B-cells stimulated to switch (By similarity), Colocalized with SIRT1 in the nucleus, Colocalized with YBX1 in nuclear speckles after genotoxic stress, Together with OGG1 is recruited to nuclear speckles in UVA-irradiated cells, Colocalized with nucleolin and NPM1 in the nucleolus, Its nucleolar localization is cell cycle dependent and requires active rRNA transcription, Colocalized with calreticulin in the endoplasmic reticulum, Translocation from the nucleus to the cytoplasm is stimulated in presence of nitric oxide (NO) and function in a CRM1-dependent manner, possibly as a consequence of demasking a nuclear export signal (amino acid position 64-80), S-nitrosylation at Cys-93 and Cys-310 regulates its nuclear-cytosolic shuttling, Ubiquitinated form is localized predominantly in the cytoplasm, SUBCELLULAR LOCATION: DNA-(apurinic or apyrimidinic site) lyase, mitochondrial: Mitochondrion |
| Protein Families | DNA repair enzymes AP/ExoA family |
| Database Links |
HGNC: 587 OMIM: 107748 KEGG: hsa:328 STRING: 9606.ENSP00000216714 UniGene: Hs.73722 |
| Pathway | DNA repair pathway |
APEX1 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA001900HC01HU | APEX1 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA001900HA01HU | APEX1 Antibody | Human, Mouse | ELISA, WB, IHC, ChIP |
| CSB-PA001900HD01HU | APEX1 Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA001900HB01HU | APEX1 Antibody, HRP conjugated | Human | ELISA |
APEX1 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA001900GA01HU | APEX1 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA234773 | APEX1 Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA000108 | Acetyl-APEX1 (K6) Antibody | Human | WB,ELISA |
| CSB-PA000109 | Acetyl-APEX1 (K7) Antibody | Human | WB,ELISA |
| CSB-PA003956 | APEX1 Antibody | Human,Mouse,Rat | WB,IHC,ELISA |
| CSB-PA005467 | APEX1 Antibody | Human | WB,ELISA |
| CSB-PA289847 | APEX1 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA242845 | APEX1 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
APEX1 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP001900HU | Recombinant Human DNA-(apurinic or apyrimidinic site) lyase(APEX1) | E.coli |
| CSB-BP001900HU CSB-MP001900HU |
Recombinant Human DNA-(apurinic or apyrimidinic site) lyase(APEX1) | Baculovirus Mammalian cell |
APEX1 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL001900HU | Human DNA-(apurinic or apyrimidinic site) lyase (APEX1) ELISA kit | serum, plasma, tissue homogenates, cell lysates | 3.9 pg/mL |
Recombinant Candida glabrata Serine/threonine-protein kinase ATG1(ATG1),partial
Express system: E.coli
Species: Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Recombinant Mouse Complement C1q subcomponent subunit A(C1qa)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Rabbit Integrin beta-8(ITGB8),partial
Express system: E.coli
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Rat Myosin-binding protein C, cardiac-type(Mybpc3),partial
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human Nuclear transport factor 2(NUTF2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Neurofilament light polypeptide(Nefl)
Express system: Yeast
Species: Mus musculus (Mouse)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
