Recombinant Human DNA repair nuclease/redox regulator APEX1 (APEX1)

In Stock
Code CSB-YP001900HU
Abbreviation Recombinant Human APEX1 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
AP endonuclease 1; AP endonuclease class I; AP lyase; APE 1; APE; APE-1; APEN; APEX 1; APEX; APEX nuclease (multifunctional DNA repair enzyme) 1; Apex nuclease 1; APEX nuclease; APEX1; APEX1_HUMAN; Apurinic endonuclease; Apurinic-apyrimidinic endonuclease 1; Apurinic/apyrimidinic (abasic) endonuclease; Apurinic/apyrimidinic endonuclease 1; Apurinic/apyrimidinic exonuclease; APX; BAP1; Deoxyribonuclease (apurinic or apyrimidinic); DNA (apurinic or apyrimidinic site) lyase; DNA-(apurinic or apyrimidinic site) lyase; mitochondrial; EC 4.2.99.18; HAP 1; HAP1; Human Apurinic endonuclease 1; MGC139790; Multifunctional DNA repair enzyme; Redox factor 1; Redox factor-1; REF 1; REF 1 protein; REF-1; REF1; REF1 protein
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
32-318aa
Target Protein Sequence
KNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression of recombinant Human APEX1 protein in Yeast cells requires incorporating a DNA fragment encoding the Human APEX1 protein (32-318aa) into a plasmid vector and transforming this vector into Yeast cells. Positive cells are screened, cultured, and induced to produce the APEX1 protein. A N-terminal 6xHis tag is attached to the protein. The recombinant Human APEX1 protein is collected and purified from the cell lysate through affinity purification. It is assessed through SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue, with a purity of exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Multifunctional protein that plays a central role in the cellular response to oxidative stress. The two major activities of APEX1 are DNA repair and redox regulation of transcriptional factors. Functions as a apurinic/apyrimidinic (AP) endodeoxyribonuclease in the DNA base excision repair (BER) pathway of DNA lesions induced by oxidative and alkylating agents. Initiates repair of AP sites in DNA by catalyzing hydrolytic incision of the phosphodiester backbone immediately adjacent to the damage, generating a single-strand break with 5'-deoxyribose phosphate and 3'-hydroxyl ends. Does also incise at AP sites in the DNA strand of DNA/RNA hybrids, single-stranded DNA regions of R-loop structures, and single-stranded RNA molecules. Has a 3'-5' exoribonuclease activity on mismatched deoxyribonucleotides at the 3' termini of nicked or gapped DNA molecules during short-patch BER. Possesses a DNA 3' phosphodiesterase activity capable of removing lesions (such as phosphoglycolate) blocking the 3' side of DNA strand breaks. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation. Acts as a loading factor for POLB onto non-incised AP sites in DNA and stimulates the 5'-terminal deoxyribose 5'-phosphate (dRp) excision activity of POLB. Plays a role in the protection from granzymes-mediated cellular repair leading to cell death. Also involved in the DNA cleavage step of class switch recombination (CSR). On the other hand, APEX1 also exerts reversible nuclear redox activity to regulate DNA binding affinity and transcriptional activity of transcriptional factors by controlling the redox status of their DNA-binding domain, such as the FOS/JUN AP-1 complex after exposure to IR. Involved in calcium-dependent down-regulation of parathyroid hormone (PTH) expression by binding to negative calcium response elements (nCaREs). Together with HNRNPL or the dimer XRCC5/XRCC6, associates with nCaRE, acting as an activator of transcriptional repression. Stimulates the YBX1-mediated MDR1 promoter activity, when acetylated at Lys-6 and Lys-7, leading to drug resistance. Acts also as an endoribonuclease involved in the control of single-stranded RNA metabolism. Plays a role in regulating MYC mRNA turnover by preferentially cleaving in between UA and CA dinucleotides of the MYC coding region determinant (CRD). In association with NMD1, plays a role in the rRNA quality control process during cell cycle progression. Associates, together with YBX1, on the MDR1 promoter. Together with NPM1, associates with rRNA. Binds DNA and RNA.
Gene References into Functions
  1. Study identified that APEX1 rs2307486 variants conferred an increased risk of mercaptopurine-related early onset neutropenia in pediatric acute lymphoblastic leukemia. PMID: 28882023
  2. The redox domain of APE1 is necessary for the active mode of stimulation of DNA glycosylases (OGG1, MPG, MBD4). APE1-catalyzed oligomerization along DNA induces helix distortions, which in turn enable conformational selection and stimulation of DNA glycosylases. PMID: 29475157
  3. APE1 removes 3' mismatches and DNA damage by placing the 3' group within the intra-helical DNA cavity via a non-base flipping mechanism. PMID: 29374164
  4. This study identified 2837 genes whose expression is significantly changed following APE1 knockdown in pancreatic ductal adenocarcinoma. PMID: 28922540
  5. MCP- and CP-induced oxidative stress alters APE1-dependent BER-pathway and also mediates cell survival signalling mechanisms via APE1 regulation, thereby promoting lung cancer cell survival and proliferation. PMID: 28887667
  6. Study uncovered a novel interaction between APE1 and PRDX1, which existed in both the nuclear and cytosolic fractions. The loss of APE1 interaction with PRDX1 promotes APE1 redox function to activate binding of the transcription factor NF-kappaB onto the promoter of IL-8 involved in cancer invasion and metastasis, resulting in its upregulation. PMID: 27388124
  7. APE1 contributes to the protective effects of resveratrol against neonatal hypoxicischemic brain injuries, and suggest that DNA repair enzymes, including APE1, may be a unique strategy for neuroprotection against this disease. PMID: 29039534
  8. Studied the association between single-nucleotide polymorphism of apurinic/apyrimidinic endonuclease 1 (APEX1) rs1760944 and risk of nasopharyngeal carcinoma in a Chinese population. PMID: 28464393
  9. this study demonstrates a novel role of extracellular APE1 in IL-6-dependent cellular responses. PMID: 28751279
  10. Our results showed that DNA base excision repair proteins APE-1 and XRCC-1 are overexpressed in tongue squamous cell carcinoma and that XRCC-1 is associated with better clinical staging and nodal status. PMID: 27925687
  11. For the first time, this work identifies Ref-1 as a novel molecular effector in T-ALL and demonstrates that Ref-1 redox inhibition results in potent inhibition of leukemia T cells, including relapsed T-ALL. These data also support E3330 as a specific Ref-1 small-molecule inhibitor for leukemia PMID: 28446640
  12. Apurinic/apyrimidinic endonuclease 1 is downregulated in Pleomorphic Adenomas of salivary gland and overexpressed in Carcinoma ex Pleomorphic Adenomas, the increased expression of this protein is associated with a more aggressive behavior in Carcinoma ex Pleomorphic Adenomas, which suggests that this protein may represent a prognostic biomarker in the studied Salivary Gland Tumors. PMID: 28523411
  13. our study demonstrates that elevation of acetylation level of APE1 in tumor could be a novel mechanism by which cells handle the elevated levels of DNA damages in response to genotoxic stress and maintain sustained proliferation. PMID: 27655688
  14. The chemotherapy-naive serum APE1 level, which correlated with its tissue level inversely associated with progression-free survival of platinum-containing doublet chemotherapy, whereas post-treatment serum APE1 level was inversely associated with overall survival. PMID: 27813497
  15. HOGG1 Ser326Cys, APE1 Asp148Glu and XRCC1 Arg399Gln polymorphisms are correlated with the risk and clinicopathological features of PACG. PMID: 28396513
  16. Through the characterization of the interactomes of APE1 with RNA and other proteins, we demonstrate here a role for APE1 in pri-miRNA processing and stability via association with the DROSHA-processing complex during genotoxic stress. We also show that endonuclease activity of APE1 is required for the processing of miR-221/222 in regulating expression of the tumor suppressor PTEN. PMID: 28986522
  17. the APEX1 Asp148Glu polymorphism might be important in stimulating the development of prostate cancer rather than its invasiveness in various populations, especially for Asians. PMID: 27248666
  18. our data reinforce the concept that non-synonymous APE1 variants present in the human population may act as cancer susceptibility alleles PMID: 27050370
  19. Data suggest that APE1 could be a potential target for NSCLC metastasis and AT101 is a potent inhibitor in further treatment of NSCLC patients. PMID: 27074577
  20. Our findings suggest that constitutive overexpression of APE1 in esophageal adenocarcinoma may be an adaptive pro-survival mechanism that protects against the genotoxic lethal effects of bile reflux episodes. PMID: 26934647
  21. our study demonstrates that increased acetylation levels of APE1 in tumor cells inhibit the limited N-terminal proteolysis of APE1 and thereby maintain the functions of APE1 to promote tumor cells' sustained proliferation and survival. PMID: 26981776
  22. Data indicate that apurinic/apyrimidinic endonuclease-1 (APE1) efficiently process an abasic ribonucleoside 5'-monophosphates (rNMPs) site in DNA and have weak endoribonuclease and 3'-exonuclease activities on r8oxoG substrate. PMID: 28977421
  23. These results suggested that the expression of APE1 was an important basis for the maintenance of poly (ADP-ribose) polymerase 1, and the deletion of APE1 may be related to the resistance of triple-negative breast cancer to olaparib. PMID: 29064327
  24. Alleles in mitochondrial transcription factor A (TFAM) and AP endonuclease 1 (APE1) are associated with reduced cognitive performance. PMID: 28242328
  25. Study shows that TRX1 and APEX1 expressions are up regulated in new Multiple Sclerosis (MS) patients compared to controls and might be implicated in pathogenesis of the disease. PMID: 28844667
  26. Ku antigen displays the AP lyase activity on a certain type of double-stranded DNA. PMID: 27129632
  27. study demonstrates that APE1 overexpression is an independent prognostic marker, but exclusively in ERG-negative prostate cancers PMID: 28467610
  28. These results suggest that degradation of endogenous APE1 by Parkin occur when cells are stressed to activate Parkin, and imply a role of Parkin in maintaining the quality of APE1, and loss of Parkin may contribute to elevated APE1 levels in glioblastoma. PMID: 27148961
  29. The efficiency of AP site cleavage by APE1 was affected by the benzo[a]pyrenyl-DNA adduct (BPDE-dG) in the opposite strand. PMID: 28065385
  30. Enforced expression of hOGG1 and hAPE significantly protected thalamic neurons and motor neurons from retrograde apoptosis induced by target deprivation and axotomy. PMID: 27364693
  31. This study supported the hypothesis that the APE1 rs1760944 T>G polymorphism may be associated with N,N-dimethylformamide -induced abnormal liver function in the Chinese Han population. PMID: 27463724
  32. Repair of the uracil adjacent to cisplatin ICLs proceeds through the classical BER pathway, highlighting the importance of specific proteins in this redundant pathway. Removal of uracil is followed by the generation of an abasic site and subsequent cleavage by AP endonuclease 1 (APE1). Inhibition of either the repair or redox domain of APE1 gives rise to cisplatin resistance. PMID: 28110804
  33. Overexpressed APE1 promotes ovarian cancer growth and metastasis. Downregulated APE1 could suppress cell activity via AP-1 pathway, suggesting that APE1 gene may be a potential therapeutic target for ovarian cancer. PMID: 27553367
  34. Our results indicate that the tumor-associated APE1 R237C variant is a possible susceptibility factor, but not likely a driver of cancer cell phenotypes. PMID: 28181292
  35. Association of the APE1 single nucleotide polymorphism rs3136820 and the levels of abasic sites in human leukocytes derived from breast cancer patients PMID: 27539671
  36. APE1 acetylation is an integral part of the base excision repair pathway for maintaining genomic integrity. PMID: 27994014
  37. Effects of monovalent (K(+)) and divalent (Mg(2+), Mn(2+), Ca(2+), Zn(2+), Cu(2+), and Ni(2+)) metal ions on DNA binding and catalytic stages of APEX1 were studied. PMID: 27063150
  38. Individuals with the variant TG genotypes had a significantly increased risk of female infertility. Whereas, a significant association between 1349T > G polymorphism and female infertility risk was not observed. PMID: 26790616
  39. APE1 Accelerates turnover of OGG1 by preventing retrograde binding to the abasic-site product. PMID: 28345889
  40. The results demonstrate a crucial role of APE1 3' to 5' exonuclease activity in combating mutations in CpG clusters caused by an intermediate of DNA demethylation during base excision repair. PMID: 27183823
  41. In an in vivo model of restenosis, which is characterized by oxidative stress, endothelial activation, and smooth muscle cell proliferation, Thioredoxin-1 protein levels are reduced in the endothelium of the carotids. APEX1 acts anti-apoptotic in endothelial cells. This anti-apoptotic effect depends on the first 20 amino acids of APEX1 PMID: 27835927
  42. While DNA conformational alteration is negligible, APE1 enzyme shows characteristic changes in the alpha helix and beta strand ratio after incubation with G. lucidum extract. The enhanced reactivity of APE1 at the molecular level in the presence of G. lucidium is attributed to this effect. PMID: 27240987
  43. These results strongly indicate that anti-inflammatory effects in TNF-alpha-stimulated endothelial cells by acetylation are tightly linked to secreted APE1/Ref-1, which inhibits TNF-alpha binding to TNFR1 by reductive conformational change, with suggestion as an endogenous inhibitor of vascular inflammation. PMID: 26964514
  44. Polymorphism in XRCC1 and APE1 gene is associated with an increased risk of COPD. PMID: 27107596
  45. Data indicate conserved amino acid residues in the nucleotide incision repair (NIR)-specific enzymes of human APE1 and Bacillus subtilis ExoA.. PMID: 27343627
  46. Based on these results, we conclude that the APEX gene polymorphism Ile64Val may be associated with an increased risk of colorectal cancer. PMID: 26146106
  47. Serum levels of APE1/Ref-1 in bladder cancer patients were significantly elevated compared to those of the control group. Serum APE1/Ref-1 levels are associated with tumor stage, grade, muscle invasion, and recurrence. PMID: 25672588
  48. OGG1 and APE1 polymorphisms are associated with stage- and sex-specific risk of colorectal carcinoma in the Taiwanese population. PMID: 27022219
  49. Our study suggested that the APE1 protein is important for the proliferation and growth of ovarian cancer cells. APE1 silencing might enhance drug-sensitivity, and thus APE1 might serve as a novel anti-OC therapeutic target. PMID: 27802207
  50. Our study identified that the APE1 -656 T>G polymorphism may contribute to the susceptibility of noise-induced hearing loss. PMID: 26507517

Show More

Hide All

Subcellular Location
Nucleus. Nucleus, nucleolus. Nucleus speckle. Endoplasmic reticulum. Cytoplasm.; [DNA-(apurinic or apyrimidinic site) endonuclease, mitochondrial]: Mitochondrion.
Protein Families
DNA repair enzymes AP/ExoA family
Database Links

HGNC: 587

OMIM: 107748

KEGG: hsa:328

STRING: 9606.ENSP00000216714

UniGene: Hs.73722

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*