Recombinant Human Fatty acid-binding protein, intestinal (FABP2)

In Stock
Code CSB-YP007942HU
Abbreviation Recombinant Human FABP2 protein
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Fatty acid-binding protein 2;Intestinal-type fatty acid-binding protein;I-FABP
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
2-132aa
Target Protein Sequence
AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.
Gene References into Functions
  1. Higher intestinal fatty acid binding protein (i-FABP) levels on admission were associated with pancreatic necrosis, systemic complications, and severe acute pancreatitis (AP). PMID: 29771764
  2. serum level in newborns positively correlated with second stage of labor duration and active pushing time PMID: 28110600
  3. We found that polymorphic Arg16Gly in the ADRB2 gene and Ala54Thr in the FABP2 gene had a discernible effect on the renal function in Chinese type 2 DN. Our data further revealed that homozygous Gly16 allele and Thr54 allele concomitantly conferred a significantly higher risk in the eGFR reduction. PMID: 29404926
  4. This study aimed to determine whether FABP2 (Ala54Thr) and MTTP (-493 G/T) genetic polymorphisms are associated with metabolic disorders in Mexican subjects. PMID: 29338565
  5. Data show that intestinal fatty acid binding protein (IFABP) is a promising prognostic marker in acute pancreatitis. PMID: 28984785
  6. There was a positive correlation between FABP2 levels and BMI, SBP and DBP, and a negative correlation with HDL-C. CONCLUSIONS: The Thr54 allele of the FABP2 Ala54Thr polymorphism was associated with an increased incidence of peripheral atherosclerosis combined with T2DM in the population studied PMID: 27778448
  7. The FABP-2 gene is located on the long arm of chromosome 4, and encodes an intracellular protein of the intestinal mucosa, responsible for the absorption and intracellular transport of fatty acids. PMID: 28760427
  8. Enterocyte injury was common in critically ill patients with pneumonia. The severity of enterocyte injury, as evidenced by the urinary FABP2/creatinine, was associated with the patient's mortality. PMID: 28164671
  9. Study reports that insulin resistance-related gene polymorphisms effects colorectal cancer (CRC) risk. The results showed that the gene polymorphism of ADIPOQ rs2241766 was associated with CRC risk. Furthermore, the interactions of ADIPOQ rs2241766, UCP2 rs659366, FABP2 rs1799883 and red meat consumption may contribute to the risk of CRC. PMID: 23826253
  10. FTO and FABP2 gene polymorphisms were significantly associated with susceptibility to metabolic syndrome and obesity in this cohort. PMID: 28738793
  11. Circulating I-FABP levels had no association with invasively-measured hemodynamic parameters, but were associated with adverse clinical outcomes in patients with acute decompensated heart failure with systolic dysfunction. PMID: 28232029
  12. The aim of this study was to measure serum I-FABP levels and provide the transition of I-FABP levels with hypothermic circulatory arrest to help in the management of intestinal perfusion. Plasma I-FABP monitoring could be a valuable method for finding an intestinal ischemia in patients with cardiovascular surgery. PMID: 27765895
  13. Urinary intestinal fatty acid-binding protein can distinguish necrotizing enterocolitis from sepsis in early stage of the disease. PMID: 27110575
  14. I-FABP is a valid serologic biomarker for early diagnosis in NEC for the premature neonates with a moderate accuracy. PMID: 26798632
  15. It is concluded that ACE (rs 4646994), FABP2 (rs1799883) and GST (GSTM1 null or positive genotype and GSTT1 null or positive genotype) genes polymorphism are associated with essential hypertension. PMID: 25357227
  16. Ala54Thr polymorphism of FABP2 modulates HDL cholesterol in Mexican-Americans with type 2 diabetes. PMID: 26703680
  17. Carriers of the Thr54 allele in FABP2 have a different metabolic response after weight loss than wild type non-A obese carriers PMID: 26316042
  18. Letter: serum intestinal-fatty acid binding protein may serve as a biomarker for refractory celiac disease. PMID: 26114190
  19. Ala54Thr polymorphism of FABP2 was associated with high triglycerides levels, but not to gallstone disease. PMID: 26019038
  20. FABP2 Ala54Thr polymorphism may have a role in type 2 diabetes, obesity, and metabolic syndrome [case-control study and meta-analysis] PMID: 25730055
  21. Both plasma and urinary I-FABP levels specifically identify necrotizing enterocolitis in preterm infants. PMID: 25793701
  22. FABP2 is a gene candidate for predisposition to Diabetic nephropathy, as it has been linked to microalbuminuria in patients with Type 2 Diabetes mellitus. PMID: 25594612
  23. To determine the allele/genotype frequencies of Ala54Thr polymorphism of the FABP2 gene. PMID: 26238699
  24. Increasing gestational age is accompanied by an increase in ileal I-FABP tissue content. PMID: 24956227
  25. Studies suggest that the fatty acid binding protein 2 (FABP2) Ala54Thr polymorphisms (rs1799883) are associated with increased susceptibility to type 2 diabetes mellitus risk (T2DM) risk among Asians but not Caucasians. PMID: 25388378
  26. ACE (I/D) and FABP2 (Ala54Thr) genes polymorphism and its susceptibility to type 2 diabetes mellitus in the North Indian population, was studied. PMID: 23468166
  27. Ala54Thr of FABP2 may be not associated with stroke risk but associated with plasma triglyceride level of stroke patients for Hunan Han population of China. PMID: 25262933
  28. systemic marker for Crohn disease activity PMID: 25807642
  29. The study suggests that the above named variant in FABP2 gene is not potential contributor to the risk of T2DM and related traits in a Saudi population. PMID: 24690233
  30. Systemic I-FABP levels appear valuable in detecting irreversible intestinal ischemia-reperfusion damage. PMID: 24100750
  31. the Ala54Thr fatty acid-binding protein 2 (FABP2) polymorphism may have a role in recurrent depression and is associated with fatty acid concentrations and waist circumference PMID: 24340071
  32. FABP2 Thr54 carriers have a better metabolic response than obese carriers with Ala54Ala genotype to high-polyunsaturated dietary fats. PMID: 23072901
  33. FABP2 gene Ala54Thr polymorphism is associated with the predisposition to physical endurance and is not associated with risk of obesity and body fat mass. PMID: 24640155
  34. INSR rs1366600, ACSL1 rs2292899 and FABP2 rs11724758 could influence the susceptibility to type 2 diabetes in Chinese Han population, most likely through their effects on the specific miRNA-binding sites. PMID: 23303383
  35. Carriers of Thr54 allele of FABP2 have a different response than wild type obese, with a lack of decrease of insulin levels, leptin levels and HOMA-Insulin resistance. PMID: 23817228
  36. Polymorphisms in FABP2 and APOL6, located at the predicted miRNAs binding sites, are identified to contribute to susceptibility to MetS in the Chinese Han population. PMID: 23911300
  37. results suggest that the higher cardiorespiratory fitness may attenuate the changes in central arterial stiffness and blood pressure that are associated with the FABP2 genotype PMID: 23362142
  38. Thr54 allele carriers responded better to a moderate-fat diet in overweight or obese subjects. PMID: 22817827
  39. Mutation frequency of FABP2 gene in the people with dyslipidemia was significantly higher than that in the people with normal blood lipids. PMID: 21861348
  40. FABP2 genetic polymorphism is associated with lower triglyceride and higher HDL-cholesterol concentrations in elderly subjects with MetS PMID: 22838187
  41. The Ala54Thr polymorphism in the FABP2 gene was not associated with obesity in the Chinese Han population of the Chengdu area. PMID: 21355293
  42. meta-analysis does not support the association between the FABP2 Ala54Thr polymorphism and body mass index PMID: 20621703
  43. We hypothesized that the triglyceride-rich lipoproteins response to diets of varied fat content is affected by the FABP2 A54T polymorphism....no evidence of an interaction, which does not support our hypothesis. PMID: 21840466
  44. The findings suggest a potential distinct role(s) of SNPs in FABP5 and FABP2 genes in T2DM in different populations. PMID: 21288588
  45. The finding of ths study was the lack of association of the Thr54/Ala54 and Thr54/Thr54 fatty acid binding protein 2 genotypes with metabolic syndrome. PMID: 20723947
  46. genetic association studies [Iran]: FABP2 SNP affects response to eicosapentaenoic acid supplementation in hypertriglyceridemia; more favorable effects on blood lipids/lipoproteins in subjects with Ala54/Thr54 genotype than with Ala54/Ala54 genotype PMID: 20080390
  47. FABP2 Thr54Thr genotype might increase the risk of non-alcoholic fatty liver disease. PMID: 19689066
  48. Thr54 allele of the FABP2 Ala54Thr is weakly associated with a higher degree of insulin resistance, higher level of fasting insulin and higher level of 2-h blood glucose. PMID: 20578207
  49. TT genotype in Ala54Thr polymorphism of FABP2 gene in patients with type 2 diabetes increased dietary fatty acid absorption, and this might increase the susceptibility to the effects of dietary lipids. PMID: 20484485
  50. data indicate that intestinal fatty acid binding protein (FABP2) expression depends on (n-3) fatty acid intake and FABP2 genotypes PMID: 20534879

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Tissue Specificity
Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum.
Database Links

HGNC: 3556

OMIM: 134640

KEGG: hsa:2169

STRING: 9606.ENSP00000274024

UniGene: Hs.282265

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*