Recombinant Human Galactoside 3 (4)-L-fucosyltransferase (FUT3), partial

Code CSB-YP009077HU1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP009077HU1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP009077HU1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP009077HU1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP009077HU1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
FUT3
Uniprot No.
Alternative Names
FUT3; FT3B; LE; 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3; Alpha-3-fucosyltransferase FUT3; Blood group Lewis alpha-4-fucosyltransferase; Lewis FT; Fucosyltransferase 3; Fucosyltransferase III; FucT-III
Species
Homo sapiens (Human)
Expression Region
35-361
Target Protein Sequence
RVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTWPFHIPVALSRCSEMVPGTADCHIT ADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFN LTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQ AHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVL GPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWA LDFCKACWKLQQESRYQTVRSIAAWFT
Protein Length
partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to both the subterminal N-acetyl glucosamine (GlcNAc) of type 1 chain (beta-D-Gal-(1->3)-beta-D-GlcNAc) glycolipids and oligosaccharides via an alpha(1,4) linkage, and the subterminal glucose (Glc) or GlcNAc of type 2 chain (beta-D-Gal-(1->4)-beta-D-GlcNAc) oligosaccharides via an alpha(1,3) linkage, independently of the presence of terminal alpha-L-fucosyl-(1,2) moieties on the terminal galactose of these acceptors and participates in the blood groups Lewis determination and expression of Lewis a (Le(a)), lewis b (Le(b)), Lewis x/SSEA-1 (Le(x)) and lewis y (Le(y)) antigens. Also catalyzes the transfer of L-fucose to subterminal GlcNAc of sialyl- and disialyl-lactotetraosylceramide to produce sialyl Lewis a (sLe(a)) and disialyl Lewis a via an alpha(1,4) linkage and therefore may regulate cell surface sialyl Lewis a expression and consequently regulates adhesive properties to E-selectin, cell proliferation and migration. Catalyzes the transfer of an L-fucose to 3'-sialyl-N-acetyllactosamine by an alpha(1,3) linkage, which allows the formation of sialyl-Lewis x structure and therefore may regulate the sialyl-Lewis x surface antigen expression and consequently adhesive properties to E-selectin. Prefers type 1 chain over type 2 acceptors. Type 1 tetrasaccharide is a better acceptor than type 1 disaccharide suggesting that a beta anomeric configuration of GlcNAc in the substrate is preferred. Lewis-positive (Le(+)) individuals have an active enzyme while Lewis-negative (Le(-)) individuals have an inactive enzyme.
Gene References into Functions
  1. High FUT3 expression is associated with breast cancer. PMID: 26908442
  2. the high expressions of BCL6 and Lewis y antigen are associated with development, high tumor burden, and worse prognosis of ovarian cancer and targeting BCL6 could be a novel therapeutic strategy for ovarian cancer treatment. PMID: 28671040
  3. the miRNA expression vector which targets the FUT3 gene can effectively inhibit the proliferation, migration and invasion abilities of KATO-III cells. PMID: 27453266
  4. Polymorphisms in FUT3 and its intestinal expression might be associated with ulcerative colitis pathogenesis. PMID: 26766790
  5. Data suggest that fucosyltransferase 3 (FUT3) gene rs28362459 and rs3745635 single nucleotide polymorphisms (SNPs) may engender the increased risk of ileocolonic and ileal Crohn's disease (CD). PMID: 26663064
  6. that the absence of alpha1,3/4-fucosyltransferase enzyme is related to breast's invasive breast carcinoma PMID: 26321244
  7. Mutations of FUT3 (rs28362459) and (rs3745635) might influence the lesion locations in CD patients. PMID: 24720527
  8. Obtained FST values reveal distinct frequencies of the FUT3 SNPs between the present sample and its representative ancestral populations. PMID: 23922852
  9. down-regulation of FUT3 and FUT5 reduces the expression of sialyl-Lewis antigens and the adhesion capacities of gastric cancer cells and allows to identify the specific alpha1-3,4 fucosyltransferases implicated in the Lewis antigens synthesis PMID: 21978830
  10. Elevated expression of Topo-I and Topo-II beta is found in Lewis(y) antigen-overexpressing ovarian cancer cells. PMID: 21542140
  11. LeY is carried by integrin alphavbeta3 and plays a critical role in attachment to cultured cells. LeY activates integrin alphavbeta3/focal adhesion kinase (FAK) signaling. PMID: 20605574
  12. At physiological levels of wall shear stress, the number of flowing cancer cells recruited to the microtube surface was dramatically reduced by FUT3 knockdown PMID: 20833389
  13. Lewis-negative genotype was associated with invasive ductal breast carcinoma but not with anatomoclinical parameters PMID: 20514537
  14. GALNT14 and FUT3/6 H-scores were significantly higher in non-small cell lung cancer cell lines sensitive to dulanermin and drozitumab versus resistant cell lines PMID: 20179215
  15. Increased expression of Lewis y antigen plays an important role in promoting cell proliferation through activating PI3K/Akt signaling pathway in ovarian carcinoma-derived RMG-I cells. PMID: 20003467
  16. PCR using sequence-specific primers DNA enables efficient genotyping of clinical samples PMID: 11668626
  17. Sialy Lewis-X antigens play an important role liver metastases of colon carcinoma. PMID: 11819805
  18. Distribution of Lewis (FUT3)genotype and allele frequencies by ethnicity in a United States population. PMID: 12424536
  19. Cys, Gln, and Tyr residues are important for FT3wt sorting into the transport vesicles possibly due to interactions with other membrane proteins PMID: 12493760
  20. study of the Lewis gene polymorphisms in a Caucasian Portuguese population with a high rate of H. pylori infection, and evaluation of the implications of mutant enzymes in Le(b) expression in the gastric mucosa PMID: 12730721
  21. results indicated that Mn2+ bound the enzyme and increased its affinity for the acceptor PMID: 14977360
  22. The heterologous enzyme hFUT3 was strongly expressed and fully functional in transgenic tobacco, which showed a delay in growth linked to a reduction of internode length. PMID: 15331092
  23. cloning and characterization of the promoter; strong correlation between the promoter activity and high expression of sialyl Le(a) observed in colon carcinoma cell lines seem to confirm the important regulatory role of FUT3 in synthesis of sialyl Le(a) PMID: 16199102
  24. LeX motif present in human milk can bind to dendritic cell-specific ICAM3-grabbing non-integrin (DC-SIGN), thereby preventing the capture and subsequent transfer of HIV-1 to CD4+ T lymphocytes. PMID: 16239964
  25. T3 overexpression in gastric cells depends upon promoter hypomethylation and FUT3 is responsible for overexpression of Le(a) in gastric cells, in vitro PMID: 16427187
  26. functional mutations of the FUT3 gene may be associated with an increased atherothrombotic disease prevalence, especially among abstainers PMID: 17383304
  27. increased CD15 expression is not due to de novo biosynthesis of CD15, but results predominantly from induction of alpha(2-3)-sialidase activity PMID: 18953356
  28. Expression of sLex antigen in breast cancer is not associated with breast cancer survival. PMID: 18977761
  29. These findings indicate that Lewis y antigen have the ability to enhance the proliferation and elevate the survival rates of RMG-I cells, which can promote the genesis and development of ovarian carcinoma PMID: 19137814
  30. Sequence analysis of FUT3 identified many SNPs, but most of them are in complete linkage disequilibrium with previously reported SNPs responsible for the Lewis-negative phenotype. PMID: 19175549
  31. results suggested that PKR is the primary target for HSV-1 early RNA during induction of FUT3, FUT5, and FUT6 PMID: 19349624
  32. in breast cancer there was a limited humoral immune response through Lewis y/IgM/CIC levels detection which correlated with MUC1/IgM/CIC PMID: 19715603

Show More

Hide All

Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Membrane-bound form in trans cisternae of Golgi.
Protein Families
Glycosyltransferase 10 family
Tissue Specificity
Highly expressed in stomach, colon, small intestine, lung and kidney and to a lesser extent in salivary gland, bladder, uterus and liver.
Database Links

HGNC: 4014

OMIM: 111100

KEGG: hsa:2525

STRING: 9606.ENSP00000305603

UniGene: Hs.169238

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1