Recombinant Human Glycodelin(PAEP)

In Stock
Code CSB-EP017381HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names PAEP
Uniprot No. P09466
Research Area Tags & Cell Markers
Alternative Names Alpha uterine protein; gD; GdA; GdF; GdS; Glycodelin A; Glycodelin; Glycodelin F; Glycodelin S; MGC138509; MGC142288; PAEG; PAEP; PAEP_HUMAN; PEG; PEP; Placental Protein 14 / Glycodelin A; Placental protein 14; PP14; Pregnancy-associated endometrial alpha-2 globulin; Progestagen-associated endometrial protein; Progesterone-associated endometrial protein
Species Homo sapiens (Human)
Source E.coli
Expression Region 19-180aa
Target Protein Sequence MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 22.4kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 10xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities
Gene References into Functions
  1. serum levels higher in preeclamptic group as compared to controls and higher in severe than in mild preeclampsia PMID: 28738719
  2. This study indicate that GdA is a complex glycoprotein including up to 6 different glycoforms specifically expressed during the different phase of the menstrual cycle; in pathologic conditions such as endometriosis, the expression profile is altered possibly related to the impaired endometrial receptivity. PMID: 28683601
  3. The results from the present study suggested that PP14 may be a novel potential biomarker for PPROM, and may be developed into a lateral flow assay for bedside application to rapidly diagnose PPROM. PMID: 29749501
  4. PKCdelta, via MAPK pathway, is involved in the glycodelin-driven cell differentiation. PMID: 27373413
  5. inverse relationship between glycodelin immunostaining and cervical intraephitelial neoplasia grade in pregnant patients PMID: 26631447
  6. the role of glycodelin-A in placental development and fetomaternal tolerance in early pregnancy. PMID: 26757357
  7. Altogether, the comprehensive characterization of glycodelin in non-small cell lung cancer provides strong support for its use as a biomarker with immune modulatory function. PMID: 25901080
  8. The current study investigates the role of melanoma cell-secreted PAEP protein in regulating T cell function. PMID: 25785839
  9. The dimeric crystal structure of the human fertility lipocalin glycodelin reveals a protein scaffold for the presentation of complex glycans. PMID: 25422905
  10. Glycodelin-A treatment reduces the adverse effect of macrophage co-culture on human sperm motility. PMID: 24733737
  11. Three months after myomectomy, endometrial glycodelin levels are significantly increased in infertile women with myoma. PMID: 24518545
  12. Glycodelin-A binds to KLF11 and is differentially activated and repressed by KLF11 in ovarian endometrium. PMID: 24060634
  13. Gd and GdA are commonly expressed in endometrial cancer tissue and seem to be of relevance in tumourigenesis. PMID: 24377825
  14. Results suggest that PP-14 may play an important role in the pathogenesis of endometriosis. PMID: 23670949
  15. Serum glycodelin levels did not predict endometrial receptivity in patients undergoing in vitro fertilization. PMID: 23585335
  16. Glycodelin-A is a potentially useful biomarker for ovarian endometriosis PMID: 23461865
  17. The glycodelin A sequence from Met24 to Leu105 is necessary and sufficient to inhibit proliferation of T cells and induce apoptosis in them. PMID: 23392770
  18. Glycodelin A was found to be an independent prognostic marker for poor prognosis in advanced ovarian cancer patients. PMID: 23036050
  19. Data suggest that, in post-menarche girls (13-19 years) with endometriosis, peritoneal fluid levels of glycodelin A, IL-6 (interleukin-6), and TNF-alpha (tumor necrosis factor-alpha) are significantly higher than in control subjects. PMID: 22563871
  20. GdA reduces the surface expression of the high-affinity IL-2R complex by down-regulating the synthesis of IL-2Ralpha (CD25). PMID: 22313865
  21. GdA induces translocation of beta-catenin molecules promoting cell-to-cell adhesion and formation of adherents junctions through cytoskeletal reorganization and promoting angiogenesis. PMID: 21999200
  22. Native glycodelin-A binds to peripheral blood monocytes inducing interleukin-6 secretion through L-selectin. PMID: 22977256
  23. data suggest a possible function of glycodelin-A in mediating cytotrophoblast differentiation PMID: 22748851
  24. A significant association between tumoral levels of glycodelin and AhR (p=0.002) in breast cancers. PMID: 22296396
  25. Preoperative glycodelin is lower in patients with uterine polyps than in menorrhagia, but increase postoperatively. This could explain the pathophysiological mechanisms for impaired endometrial receptivity in the presence of endometrial polyps. PMID: 22239027
  26. glycodelin plays an important role in the pathogenesis of lung cancer and lung metastases PMID: 21168900
  27. GdA interacts with Siglec-6 to suppress trophoblast invasiveness by down-regulating the ERK/c-Jun signaling pathway. PMID: 21880722
  28. Gene expression analysis revealed a correlation between progestagen-associated endometrial protein expression in sporadic and familial non-BRCA1/2 breast cancers PMID: 20676758
  29. At ovulation (day LH + 1), glycodelin concentration is increased in endometrium (and thus in endometrial flushing fluid) of infertile women with abnormal fallopian tubes compared to fertile controls. PMID: 21292383
  30. GdA (not GdC, GdS, or deglycosylated GdA) up-regulates expression of Fas, suppresses MAPK signaling, and enhances cell death in isolated Th-1 cells (but not Th-2 cells). These data suggest GdA may contribute to Th-2/Th-1 shift as seen in pregnancy. PMID: 21227941
  31. significant differences in glycodelin and IL-10 between the fibroid and the control group suggesting that submucous fibroids may have an adverse effect on endometrial receptivity. PMID: 20880745
  32. PP14 arrests T cells in a unique activated state that is not accompanied with the acquisition of effector function. PMID: 20886106
  33. we propose that GdA in the oviductal fluid binds to spermatozoa, potentiating them for zona pellucida-induced acrosome reaction via the cAMP/PKA/ERK/IP3R1 pathway PMID: 20843776
  34. These data strongly implicate the PAEP gene as a tumour growth promoter with oncogenic properties and a potential therapeutic target for patients with advanced melanoma. PMID: 19799645
  35. GdA plays a protective role during pregnancy by regulating the cytolytic activity of CD8(+) T cells. PMID: 20638131
  36. glycodelin-A contributes to the cytokine shift in early pregnancy PMID: 19945098
  37. analysis of glycodelin expression in correlation to grading, nodal involvement and steroid receptor expression in human breast cancer patients PMID: 20592348
  38. glycodelin-A expression is correlated to grading and staging in ovarian carcinoma tissue PMID: 20592354
  39. enables the spermatozoa to become more competent in fertilization; review PMID: 19857900
  40. In the endometrium, both Glycodelin and Plexin-B1 are exhibiting a cyclic pattern suggesting a possible steroid regulation and a role in endometrial receptivity PMID: 20040080
  41. Patients with severe dysmenorrhoea had increased peritoneal fluid TNF-alpha and glycodelin. TNF-alpha and glycodelin may play role in endometriosis and severity of menstrual pain. PMID: 19903048
  42. Synthesized in the granulosa cells at late secondary follicle stage; function in the ovarian follicle PMID: 11818517
  43. PP14 is a soluble regulatory protein that dampens T cell responses by its physical presence in the contact site at the time of T cell receptor triggering. PMID: 11884441
  44. uterine glycodelin flushings are elevated in patients with both polyps and leiomyomas; elevated glycodelin levels in the follicular and peri-ovulatory period may impair fertilization and implantation PMID: 12351556
  45. new immunoregulatory model for PP14: one of its surface molecular targets, CD45, mediates its T cell inhibitory activity, accounting for the intriguing capacity of PP14 to elevate TCR activation thresholds and thereby down-regulate T cell activation PMID: 12556471
  46. Oxidants and antioxidants affect the expression of glycodelin PMID: 12654469
  47. ZIF-1 is a differentially glycosylated isoform of glycodelin that potently inhibits human sperm-egg interaction. PMID: 12672671
  48. PP14 as a soluble regulatory factor capable of interacting with both T and B cells in a carbohydrate-dependent manner and as a result it can affect both cellular and humoral immune responses. PMID: 12826085
  49. protein is apoptotically inactive in the non-sialylated form: differential glycosylation modulates the function of the different glycodelin isoforms. PMID: 14679205
  50. During first trimester, serum glycodelin and IGFBP-1 are markedly decreased in polycystic ovary syndrome(PCOS), implicating endometrial epithelial and stromal dysfunction during periimplantation and early pregnancy in early pregnancy loss. PMID: 14764802
  51. binding of glycodelin-A and -F to sperm PMID: 14973265
  52. There was no significant difference between natural and stimulated cycles in concentrations of PP 14 and CA-125 in uterine flushings performed in the mid-luteal phase. PMID: 15016783
  53. Placental protein 14 impairs the down-regulation of GATA-3 transcriptional regulator expression that normally accompanies T cell activation, which is a prerequisite for development of T helper type 1 cells. PMID: 15494501
  54. glycodelin-S in seminal plasma maintains the uncapacitated state of human spermatozoa PMID: 15883155
  55. Requirement for glycodelin for endometrial epithelial differentiation. Clue for possible therapeutic strategy to modulate endometrial function by targeting glycodelin. PMID: 16123169
  56. placental protein 14 promotes CD45 dimerization and clustering, a phenomenon that may regulate CD45 activity PMID: 16269626
  57. Glycodelin transfection reduces proliferation of endometrial adenocarcinoma cells, induces morphologic changes, and reduces expression of carcinoma- and chemoresistance-associated genes, such as MUC1 and Bcl-XL. PMID: 16325596
  58. Patients with normal gonadotropin responses who were undergoing IVF demonstrated increased VEGF production to glycodelin, whereas poor responders had a decreased response to glycodelin. PMID: 16647384
  59. Down-regulation of PRB in the endometrium is concomitant with the presence of glycodelin in the endometrium, suggesting interaction. PMID: 16759928
  60. Peri-implantation levels of glycodelin are lower in women with a history of recurrent miscarriage. PMID: 17049713
  61. Glycodelin positively regulates cell motility acting as mediator of histone deacetylase inhibitor-enhanced endometrial cell migration, suggesting involvement of glycodelin in dynamic endometrial gland morphogenesis during menstrual cycle. PMID: 17068141
  62. Glycodelin was demonstrated in normal endometrium at the protein and mRNA levels. PMID: 17070198
  63. Glycodelin may act as an autocrine factor within endometriotic implants to increase VEGF expression during oxidative stress. PMID: 17132480
  64. FUT5 is a receptor of glycodelin-A and zona pellucida proteins, and glycodelin-A inhibits spermatozoa-zona binding by blocking the binding of sperm FUT5 to the zona pellucida PMID: 17148576
  65. Gd and cyclooxygenase-2 might play important roles in promoting neovascularization and cell proliferation in the establishment of endometriosis PMID: 17156191
  66. glycodelin oligosaccharides vary significantly from one reproductive tissue to another and have an effect on its own secretion and role in cell communication PMID: 17329396
  67. Variability of seminal plasma glycodelin (Gd) adherence to spermatozoa suggests differences in sperm membrane properties according to the quality of the sperm; there is reduced Gd binding to normal-shaped male gametes compared with abnormal spermatozoa. PMID: 17482165
  68. Prescence of glycodelin in peripheral white blood cells was demonstrated. PMID: 17570010
  69. determination of Glycodelin A is not sensitive or specific enough for use as a tumour marker. PMID: 17649816
  70. Removal of sialic acid residues from the active populations of GdA abrogates the activity of the molecule, suggesting that the extent of sialylation might be a factor regulating the activity of GdA. PMID: 17716661
  71. glycodelin is a key regulatory protein of implantation and suggests that suberoylanilide hydroxamic acid may have a capacity to supplant steroid derivatives in the treatment of infertility. PMID: 17720699
  72. Glycodelin A initiates mitochondrial stress-mediated apoptosis in T cells by a pathway that is distinct and independent from the TCR signaling pathway. PMID: 18155767
  73. Recombinant GdA, like natural GdA is glycosylated and secreted, and they both induced apototic changes in monocytic U937 cells and primary human monocytes. PMID: 18203874
  74. Glycodelin expression was significantly decreased compared with normal gestation. In mole pregnancy, an upregulation of Gd in the first 8 weeks of pregnancy was present. PMID: 18256018
  75. Glycodelin may be one of the molecules that contributes to the loss of cellular homeostasis in endometriotic lesions. PMID: 18402941
  76. Glycodelin-induced differentiation was associated with reduced expression of oncogenes and increased expression of tumor suppressor genes. Our results suggest that glycodelin acts as a tumor suppressor in breast cancer PMID: 18720404
  77. GdA is secreted in high quantities from human endometrium during implantation and thereby helps to shape the unique immunological interaction between mother and fetus via decidual dendritic cells. PMID: 19032611
  78. Immunohistochemistry detected inhibin-alpha, -betaA and -betaB, Ki67, p53 and glycodelin A in invasive trophoblastic mole. PMID: 19195690
  79. Gd might be an additional marker for the differentiation of breast cancer tissue PMID: 19224449
  80. Glycodelin-A inhibits the invasion of extravillous cytotrophoblasts mainly by suppressing the activity of MMP2 and MMP9 in a glycosylation-dependent fashion. PMID: 19520712
  81. impairs in vitro dendritic cell maturation PMID: 19609241
  82. the galectin-1 glycoprotein receptor CD7 maybe a novel target for GdA on T cells. PMID: 19683346

Show More

Hide All

Subcellular Location Secreted
Protein Families Calycin superfamily, Lipocalin family
Tissue Specificity This protein is, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy (PubMed:3667877). Glycodelin-A is expressed in amniotic fluid, endometrium/decidua and ma
Database Links

HGNC: 8573

OMIM: 173310

KEGG: hsa:5047

STRING: 9606.ENSP00000277508

UniGene: Hs.532325

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1