Recombinant Human Glycodelin(PAEP)

In Stock
Code CSB-EP017381HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P09466
Lead Time 3-7 business days
Relevance This protein is, quantitatively, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Placental protein 14 Short name: PP14 Pregnancy-associated endometrial alpha-2 globulin Short name: PAEG Short name: PEG Progestagen-associated endometrial protein Progesterone-associated endometrial protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Research Area Tags & Cell Markers
Source E.coli
Gene Names PAEP
Protein Names Recommended name: Glycodelin Short name= GDAlternative name(s): Placental protein 14 Short name= PP14 Pregnancy-associated endometrial alpha-2 globulin Short name= PAEG Short name= PEG Progestagen-associated endometrial
Expression Region 19-180aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 22.4kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities
Subcellular Location Secreted
Protein Families Calycin superfamily, Lipocalin family
Tissue Specificity This protein is, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy (PubMed:3667877). Glycodelin-A is expressed in amniotic fluid, endometrium/decidua and ma
Database Links

HGNC: 8573

OMIM: 173310

KEGG: hsa:5047

STRING: 9606.ENSP00000277508

UniGene: Hs.532325

Related Products

PAEP Antibodies

PAEP Antibodies for Homo sapiens (Human)

PAEP Antibodies for Human

PAEP Proteins

PAEP Proteins for Homo sapiens (Human)

PAEP ELISA Kit

PAEP ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.