Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PAEP

Uniprot No.

P09466

Alternative Names

Alpha uterine protein; gD; GdA; GdF; GdS; Glycodelin A; Glycodelin; Glycodelin F; Glycodelin S; MGC138509; MGC142288; PAEG; PAEP; PAEP_HUMAN; PEG; PEP; Placental Protein 14 / Glycodelin A; Placental protein 14; PP14; Pregnancy-associated endometrial alpha-2 globulin; Progestagen-associated endometrial protein; Progesterone-associated endometrial protein

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

19-180aa

Target Protein Sequence

MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

23.9kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The Recombinant Human PAEP is a superior quality protein meticulously engineered for your scientific advancement. Featuring the full-length Glycodelin protein (also known as GD, Placental protein 14, and Pregnancy-associated endometrial alpha-2 globulin), this product plays an important role in various physiological processes and is sourced from mammalian cells to ensure high fidelity and functionality.

With an expression region of 19-180 amino acids, our Recombinant Human PAEP is presented as a full-length mature protein. The N-terminal 10xHis and C-terminal Myc tags enable easy purification and detection, streamlining your workflow. Boasting a purity greater than 90% as determined by SDS-PAGE, this product is available in both liquid and lyophilized powder formats. Invest in Recombinant Human PAEP to propel your research to new heights with the reliability and performance you expect from a top-quality product.

Target Background

Function

Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities. Glycodelin-C stimulates binding of spermatozoa to the zona pellucida. Glycodelin-F inhibits spermatozoa-zona pellucida binding and significantly suppresses progesterone-induced acrosome reaction of spermatozoa. Glycodelin-S in seminal plasma maintains the uncapacitated state of human spermatozoa.

Gene References into Functions

serum levels higher in preeclamptic group as compared to controls and higher in severe than in mild preeclampsia PMID: 28738719
This study indicate that GdA is a complex glycoprotein including up to 6 different glycoforms specifically expressed during the different phase of the menstrual cycle; in pathologic conditions such as endometriosis, the expression profile is altered possibly related to the impaired endometrial receptivity. PMID: 28683601
The results from the present study suggested that PP14 may be a novel potential biomarker for PPROM, and may be developed into a lateral flow assay for bedside application to rapidly diagnose PPROM. PMID: 29749501
PKCdelta, via MAPK pathway, is involved in the glycodelin-driven cell differentiation. PMID: 27373413
inverse relationship between glycodelin immunostaining and cervical intraephitelial neoplasia grade in pregnant patients PMID: 26631447
the role of glycodelin-A in placental development and fetomaternal tolerance in early pregnancy. PMID: 26757357
Altogether, the comprehensive characterization of glycodelin in non-small cell lung cancer provides strong support for its use as a biomarker with immune modulatory function. PMID: 25901080
The current study investigates the role of melanoma cell-secreted PAEP protein in regulating T cell function. PMID: 25785839
The dimeric crystal structure of the human fertility lipocalin glycodelin reveals a protein scaffold for the presentation of complex glycans. PMID: 25422905
Glycodelin-A treatment reduces the adverse effect of macrophage co-culture on human sperm motility. PMID: 24733737
Three months after myomectomy, endometrial glycodelin levels are significantly increased in infertile women with myoma. PMID: 24518545
Glycodelin-A binds to KLF11 and is differentially activated and repressed by KLF11 in ovarian endometrium. PMID: 24060634
Gd and GdA are commonly expressed in endometrial cancer tissue and seem to be of relevance in tumourigenesis. PMID: 24377825
Results suggest that PP-14 may play an important role in the pathogenesis of endometriosis. PMID: 23670949
Serum glycodelin levels did not predict endometrial receptivity in patients undergoing in vitro fertilization. PMID: 23585335
Glycodelin-A is a potentially useful biomarker for ovarian endometriosis PMID: 23461865
The glycodelin A sequence from Met24 to Leu105 is necessary and sufficient to inhibit proliferation of T cells and induce apoptosis in them. PMID: 23392770
Glycodelin A was found to be an independent prognostic marker for poor prognosis in advanced ovarian cancer patients. PMID: 23036050
Data suggest that, in post-menarche girls (13-19 years) with endometriosis, peritoneal fluid levels of glycodelin A, IL-6 (interleukin-6), and TNF-alpha (tumor necrosis factor-alpha) are significantly higher than in control subjects. PMID: 22563871
GdA reduces the surface expression of the high-affinity IL-2R complex by down-regulating the synthesis of IL-2Ralpha (CD25). PMID: 22313865
GdA induces translocation of beta-catenin molecules promoting cell-to-cell adhesion and formation of adherents junctions through cytoskeletal reorganization and promoting angiogenesis. PMID: 21999200
Native glycodelin-A binds to peripheral blood monocytes inducing interleukin-6 secretion through L-selectin. PMID: 22977256
data suggest a possible function of glycodelin-A in mediating cytotrophoblast differentiation PMID: 22748851
A significant association between tumoral levels of glycodelin and AhR (p=0.002) in breast cancers. PMID: 22296396
Preoperative glycodelin is lower in patients with uterine polyps than in menorrhagia, but increase postoperatively. This could explain the pathophysiological mechanisms for impaired endometrial receptivity in the presence of endometrial polyps. PMID: 22239027
glycodelin plays an important role in the pathogenesis of lung cancer and lung metastases PMID: 21168900
GdA interacts with Siglec-6 to suppress trophoblast invasiveness by down-regulating the ERK/c-Jun signaling pathway. PMID: 21880722
Gene expression analysis revealed a correlation between progestagen-associated endometrial protein expression in sporadic and familial non-BRCA1/2 breast cancers PMID: 20676758
At ovulation (day LH + 1), glycodelin concentration is increased in endometrium (and thus in endometrial flushing fluid) of infertile women with abnormal fallopian tubes compared to fertile controls. PMID: 21292383
GdA (not GdC, GdS, or deglycosylated GdA) up-regulates expression of Fas, suppresses MAPK signaling, and enhances cell death in isolated Th-1 cells (but not Th-2 cells). These data suggest GdA may contribute to Th-2/Th-1 shift as seen in pregnancy. PMID: 21227941
significant differences in glycodelin and IL-10 between the fibroid and the control group suggesting that submucous fibroids may have an adverse effect on endometrial receptivity. PMID: 20880745
PP14 arrests T cells in a unique activated state that is not accompanied with the acquisition of effector function. PMID: 20886106
we propose that GdA in the oviductal fluid binds to spermatozoa, potentiating them for zona pellucida-induced acrosome reaction via the cAMP/PKA/ERK/IP3R1 pathway PMID: 20843776
These data strongly implicate the PAEP gene as a tumour growth promoter with oncogenic properties and a potential therapeutic target for patients with advanced melanoma. PMID: 19799645
GdA plays a protective role during pregnancy by regulating the cytolytic activity of CD8(+) T cells. PMID: 20638131
glycodelin-A contributes to the cytokine shift in early pregnancy PMID: 19945098
analysis of glycodelin expression in correlation to grading, nodal involvement and steroid receptor expression in human breast cancer patients PMID: 20592348
glycodelin-A expression is correlated to grading and staging in ovarian carcinoma tissue PMID: 20592354
enables the spermatozoa to become more competent in fertilization; review PMID: 19857900
In the endometrium, both Glycodelin and Plexin-B1 are exhibiting a cyclic pattern suggesting a possible steroid regulation and a role in endometrial receptivity PMID: 20040080
Patients with severe dysmenorrhoea had increased peritoneal fluid TNF-alpha and glycodelin. TNF-alpha and glycodelin may play role in endometriosis and severity of menstrual pain. PMID: 19903048
Synthesized in the granulosa cells at late secondary follicle stage; function in the ovarian follicle PMID: 11818517
PP14 is a soluble regulatory protein that dampens T cell responses by its physical presence in the contact site at the time of T cell receptor triggering. PMID: 11884441
uterine glycodelin flushings are elevated in patients with both polyps and leiomyomas; elevated glycodelin levels in the follicular and peri-ovulatory period may impair fertilization and implantation PMID: 12351556
new immunoregulatory model for PP14: one of its surface molecular targets, CD45, mediates its T cell inhibitory activity, accounting for the intriguing capacity of PP14 to elevate TCR activation thresholds and thereby down-regulate T cell activation PMID: 12556471
Oxidants and antioxidants affect the expression of glycodelin PMID: 12654469
ZIF-1 is a differentially glycosylated isoform of glycodelin that potently inhibits human sperm-egg interaction. PMID: 12672671
PP14 as a soluble regulatory factor capable of interacting with both T and B cells in a carbohydrate-dependent manner and as a result it can affect both cellular and humoral immune responses. PMID: 12826085
protein is apoptotically inactive in the non-sialylated form: differential glycosylation modulates the function of the different glycodelin isoforms. PMID: 14679205
During first trimester, serum glycodelin and IGFBP-1 are markedly decreased in polycystic ovary syndrome(PCOS), implicating endometrial epithelial and stromal dysfunction during periimplantation and early pregnancy in early pregnancy loss. PMID: 14764802

Hide All

Subcellular Location

Secreted.

Protein Families

Calycin superfamily, Lipocalin family

Tissue Specificity

This protein is, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy. Glycodelin-A is expressed in amniotic fluid, endometrium/decidua and maternal serum (at

Database Links

HGNC: 8573

OMIM: 173310

KEGG: hsa:5047

STRING: 9606.ENSP00000277508

UniGene: Hs.532325

Code	CSB-MP017381HU
Abbreviation	Recombinant Human PAEP protein
MSDS	MSDS Datasheet
Size	$590
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Glycodelin (PAEP)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage