Code | CSB-RP148194h |
MSDS | |
Size | $224 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
The gene fragment corresponding to the 29-222aa of the human HLA-DPA1 protein was synthesized, with appropriate restriction sites suitable for in-frame cloning into an expression vector, with N-terminal 6xHis tag. The E.coli was transformed with the expression vector, and the clone was expressed upon certain induction. After the induced cell centrifugation, the recombinant protein was purified from the cell extract and presented as N-terminal 6xHis-tagged fusion. This recombinant human HLA-DPA1 protein's purity is greater than 90% assayed by SDS-PAGE. The HLA-DPA1 protein ran to a band of about 26 kDa molecular weight on the gel.
HLA-DPA1, also known as HLA-DP1A, HLASB or DPA1, belongs to the HLA class II alpha chain paralogues. HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). HLA-DPA1 function as an MHC class II receptor to participate in immune response and antigenic peptides presentation. Clinical study on adrenocortical tumors (ACT) indicated low expression of HLA-DPA1 was associated with poor prognosis. HLA-DPA1 and several other MHC class II genes’ down-regulation were involved as they function in antigen presentation.
There are currently no reviews for this product.
We are trying to develop a multiplexing assay on Luminex to detect the HLA Class I and II antibodies in individuals.
We are looking for manufacturer who can provide us human derived recombined HLA class I and II antigens, checked on your website and find some Locus antigens are available with you. For the panel designing we need antigens of locu DPA1.
Could you please provide some idea about it?
AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTE