Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-RP148294h |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | P01906 |
| Relevance | Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents th on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As mbrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal syst where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The roval of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell mbrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | DX alpha chainHLA class II histocompatibility antigen, DQ(6) alpha chainHLA-DQA1MHC class II DQA2 |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | EDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSKFPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSE |
| Research Area | Immunology |
| Source | E.coli |
| Gene Names | HLA-DQA2 |
| Expression Region | 24-214aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 25.6kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading. |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus, trans-Golgi network membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein |
| Protein Families | MHC class II family |
| Tissue Specificity | Restricted to skin Langerhans cells, although some expression at low levels may occur at the surface of B lymphoblastoid cells. |
| Database Links |
HGNC: 4943 OMIM: 613503 KEGG: hsa:3118 STRING: 9606.ENSP00000364076 UniGene: Hs.591798 |
| Pathway |
Antigen processing and presentation
Hematopoietic cell lineage Th1 and Th2 cell differentiation Th17 cell differentiation |
HLA-DQA2 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA14829D0Rb | HLA-DQA2 Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA14829B0Rb | HLA-DQA2 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA14829C0Rb | HLA-DQA2 Antibody, FITC conjugated | Human | ELISA |
HLA-DQA2 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA14829A0Rb | HLA-DQA2 Antibody | Human | ELISA, IHC |
HLA-DQA2 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-CF010493HU | Recombinant Human HLA class II histocompatibility antigen, DQ alpha 2 chain(HLA-DQA2) | in vitro E.coli expression system |
| CSB-YP010493HU CSB-EP010493HU CSB-BP010493HU CSB-MP010493HU |
Recombinant Human HLA class II histocompatibility antigen, DQ alpha 2 chain(HLA-DQA2),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Lymphocyte-specific protein 1(LSP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Bifunctional Epoxide hydrolase 2(EPHX2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Atrial natriuretic peptide receptor 3(Npr3),partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Aldehyde dehydrogenase family 1 member A3(ALDH1A3)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Translationally-controlled tumor protein(Tpt1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human E3 ubiquitin-protein ligase RBX1(RBX1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Coagulation factor XI(F11),partial
Express system: E.coli
Species: Homo sapiens (Human)
