Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5(ITIH5),partial

In Stock
Code CSB-EP768213HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q86UX2
Lead Time 3-7 business days
Abbreviation ITIH5
Relevance May act as a tumor suppressor.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE
Source E.coli
Gene Names ITIH5
Protein Names Recommended name: Inter-alpha-trypsin inhibitor heavy chain H5 Short name= ITI heavy chain H5 Short name= ITI-HC5 Short name= Inter-alpha-inhibitor heavy chain 5
Expression Region 35-161aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 30.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May act as a tumor suppressor.
Subcellular Location Secreted
Protein Families ITIH family
Tissue Specificity Abundantly expressed in placenta. Less abundant expression in mammary gland and ovary. Expression is barely detectable levels in all other tissues tested.
Database Links

HGNC: 21449

OMIM: 609783

KEGG: hsa:80760

STRING: 9606.ENSP00000256861

UniGene: Hs.498586

Q&A and Customer Reviews

Q&A
Q:

Regarding your recombinant proteins CSB-EP768213HU , do you know if one contain “animal byproducts (according to EUL decree: (EG) Number. 1069/2009)”?

A:
Thanks for your inquiry.
We confirm that the protein is recombinant expressed protein, it isn't derived from animal and does't contain any animal byproduct.
Customer Reviews

Related Products

ITIH5 Antibodies

ITIH5 Antibodies for Homo sapiens (Human)

ITIH5 Proteins

ITIH5 Proteins for Homo sapiens (Human)

ITIH5 ELISA Kit

ITIH5 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.