Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5(ITIH5),partial

In Stock
Code CSB-EP768213HU
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names ITIH5
Uniprot No. Q86UX2
Species Homo sapiens (Human)
Source E.coli
Expression Region 35-161aa
Target Protein Sequence VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 30.6kDa
Protein Length partial protein
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Tris-based buffer,50% glycerol
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
Buffer before Lyophilization Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 3-7 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

 Q&A
Q:

Regarding your recombinant proteins CSB-EP768213HU , do you know if one contain “animal byproducts (according to EUL decree: (EG) Number. 1069/2009)”?

A:
Thanks for your inquiry.
We confirm that the protein is recombinant expressed protein, it isn't derived from animal and does't contain any animal byproduct.
 Customer Reviews

Target Data

Function May act as a tumor suppressor.
Subcellular Location Secreted
Protein Families ITIH family
Tissue Specificity Abundantly expressed in placenta. Less abundant expression in mammary gland and ovary. Expression is barely detectable levels in all other tissues tested.
Database Links

HGNC: 21449

OMIM: 609783

KEGG: hsa:80760

STRING: 9606.ENSP00000256861

UniGene: Hs.498586

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.