Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial

In Stock
Code CSB-EP768213HU
Abbreviation Recombinant Human ITIH5 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ITIH5
Uniprot No.
Alternative Names
ITIH5; KIAA1953; PP14776; UNQ311/PRO354; Inter-alpha-trypsin inhibitor heavy chain H5; ITI heavy chain H5; ITI-HC5; Inter-alpha-inhibitor heavy chain 5
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
35-161aa
Target Protein Sequence
VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.6kDa
Protein Length
partial protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human ITIH5 contains amino acids 35-161. This ITIH5 protein is expected to have a theoretical molecular weight of 30.6 kDa. The ITIH5 protein was expressed in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the ITIH5 encoding gene fragment was conducted, allowing for easier detection and purification of the ITIH5 protein in subsequent stages.

Human inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5) functions as a key player in extracellular matrix stability and inflammation regulation. By interacting with hyaluronic acid, ITIH5 contributes to maintaining tissue integrity. In reproductive biology, ITIH5 plays a role in endometrial receptivity and embryo implantation, highlighting its significance in fertility research. Additionally, ITIH5 holds potential in cancer studies, where it may serve as a biomarker for certain malignancies. Its involvement in immune responses extends its relevance to immunology research. Unraveling the diverse functions of ITIH5 offers valuable insights into tissue homeostasis, reproductive processes, cancer therapeutics, and immunological mechanisms, advancing research across multiple disciplines.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Regarding your recombinant proteins CSB-EP768213HU , do you know if one contain “animal byproducts (according to EUL decree: (EG) Number. 1069/2009)”?

A:
Thanks for your inquiry.
We confirm that the protein is recombinant expressed protein, it isn't derived from animal and does't contain any animal byproduct.

Target Background

Function
May act as a tumor suppressor.
Gene References into Functions
  1. ITIH5 may represent a novel modulator of TGF-beta superfamily signaling. PMID: 28940371
  2. Results provide evidence that ITIH5 triggers a reprogramming of breast cancer cells through global epigenetic changes effecting DAPK1. ITIH5 may represent an ECM modulator in epithelial breast tissue mediating suppression of tumor initiating cancer cell characteristics which are thought being responsible for the metastasis of breast cancer. PMID: 28231808
  3. Low ITIH5 expression is associated with liver metastasis in pancreatic cancer. PMID: 28289921
  4. This is the first study so far showing a putative tumor suppressive function of ITIH5 in cervical carcinogenesis. PMID: 28059468
  5. The current study describes a novel mechanism linking the TSG-6 transfer of the newly described HC5 to the HA-dependent control of cell phenotype. The interaction of HC5 with cell surface HA was essential for TGFbeta1-dependent differentiation of fibroblasts to myofibroblasts, highlighting its importance as a novel potential therapeutic target. PMID: 27143355
  6. ITIH5 may be a novel putative tumor suppressor gene in NSCLC with a potential molecular significance in the squamoid ADC subtype and further clinical impact for risk stratification of adenocarcinoma patients. PMID: 26252352
  7. Hence, we can strengthen the presumption that ITIH5 may constitute a novel regulatory molecule of the human skin that could play an important role in in fl ammation via its interaction with hyaluronic acid. PMID: 25809190
  8. ITIH5 expression is decreased in gastric cancer and that low expression of this protein is associated with poor clinical outcome. PMID: 24913813
  9. ITIH5 is a novel putative tumor suppressor gene in colon cancer with a potential impact in the CIMP-related pathway. PMID: 25093535
  10. Tumor-specific methylation of the three-gene panel (ITIH5, DKK3, and RASSF1A) might be a valuable biomarker for the early detection of breast cancer. PMID: 23320751
  11. provide evidence that down-regulation of ITIH5 by aberrant DNA hypermethylation may provoke invasive phenotypes in human bladder cancer PMID: 24265292
  12. ITIH5 gene expression is regulated both by obesity and by the region between visceral and subcutaneous adipose tissue. PMID: 22616691
  13. ITIH-5 is highly expressed in sc adipose tissue, increased in obesity, down regulated after weight loss, and associated with measures of body size and metabolism. PMID: 21852814
  14. expression is consistantly lost or strongly downregulated in invasive ductal carcinoma; proposed that loss of ITIH5 expression may be involved in breast cancer development PMID: 14744536
  15. Promoter methylation-mediated loss of ITIH5 expression is associated with unfavourable outcome in breast cancer patients. PMID: 17653090
  16. Both ITIH5 protein expression and ITIH5 promoter methylation may serve as prognostic biomarkers, thereby helping improve clinical patient outcome. PMID: 18810445

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
ITIH family
Tissue Specificity
Abundantly expressed in placenta. Less abundant expression in mammary gland and ovary. Expression is barely detectable levels in all other tissues tested.
Database Links

HGNC: 21449

OMIM: 609783

KEGG: hsa:80760

STRING: 9606.ENSP00000256861

UniGene: Hs.498586

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*