Recombinant Human Kallikrein-2 (KLK2)

In Stock
Code CSB-EP012453HU
Abbreviation Recombinant Human KLK2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Glandular kallikrein 2; Glandular kallikrein-1; hGK 1; hGK-1; hK2; Kallikrein 2 prostatic; Kallikrein related peptidase 2; kallikrein, glandular; Kallikrein, prostatic; Kallikrein-2; KLK 2; Klk-2; Klk2; KLK2_HUMAN; KLK2A 2; KLK2A2; MGC12201; Tissue kallikrein 2; Tissue kallikrein-2; Ton
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
25-261aa
Target Protein Sequence
IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 25-261 form the expressed segment for recombinant Human KLK2. The theoretical molecular weight of the KLK2 protein is 30.2 kDa. This KLK2 recombinant protein is manufactured in e.coli. The KLK2 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant KLK2 protein during the following stages.

Human kallikrein-2 (KLK2) is a serine protease belonging to the kallikrein-related peptidase family. It is primarily expressed in the prostate gland and is involved in several physiological processes. KLK2 is best known for its role in the cleavage of semenogelins, proteins found in seminal fluid, contributing to the liquefaction of semen after ejaculation. KLK2 is also used as a biomarker for prostate cancer detection and monitoring, as its levels in blood are elevated in individuals with prostate cancer. Understanding the functions and regulation of KLK2 is crucial for advancing prostate cancer therapeutics, making it a significant target for research in the field of urology and oncology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Gene References into Functions
  1. glycosylation changes the enzymatic activity of KLK2 in a drastically substrate-dependent manner. PMID: 26582203
  2. The results indicated that W-hK2 had a defect in cellular trafficking due to its misfolding and that it activated the unfolded protein response, suggesting a mechanism to explain the association of the T allele with higher prostate cancer risk. PMID: 25847286
  3. miR-378 was predicted to target both KLK2 and KLK4 and downregulated levels detected in prostate cancer patients. PMID: 25153390
  4. The differential regulation of alternative transcripts (using KLK2, KLK3 and KLK4 as models) by androgens and anti-androgens as an indicator of prostate cancers, was investigated. PMID: 25153393
  5. Structure-function analyses of KLK2 establish the 99-loop as master regulator of its activity. PMID: 25326387
  6. Predictions based on levels of four kallikrein markers, including KLK2, in blood distinguish between pathologically insignificant and aggressive disease after radical prostatectomy with good accuracy. PMID: 23683475
  7. Alteration of cellular junctions in benign prostatic hyperplasia could contribute to the presence of luminal epithelial secreted proteins prostate specific antigen (PSA)2 and and KLK2 in the stromal compartment. PMID: 24711254
  8. we present the first evidence that KLK2 can also function as an androgen receptor modulator that may modulate cell growth after the development of castration-resistant prostate cancer PMID: 24122203
  9. Associations observed in young, healthy men between the seminal plasma and serum concentrations of hK2 and PSA and several genetic variants in KLK2 and KLK3 could be useful to refine models of PSA cutoff values in prostate cancer testing. PMID: 24270797
  10. Genetic variants at ATF7IP and KLK2 contribute to the variance of %fPSA. PMID: 23359319
  11. Two SNPs, in beta-microseminoprotein at and in kallikrein-related peptidase 2 at, are associated with PCA3 score at genome-wide significance level PMID: 23555189
  12. TK promotes vessel growth by increasing the number of EPCs and enhancing their functional properties through the kinin B(2) receptor-Akt signaling pathway. PMID: 22435954
  13. An exploratory study of a KLK2 polymorphism as a prognostic marker in prostate cancer was found to be less likely associated with low Gleason score morphology. PMID: 21178268
  14. we identifiedand genotyped novel single-nucleotide polymorphisms in cancer cases and controls which verified prior associations in KLK2 and in MSMB (but not in KLK3) with prostate cancer PMID: 20424135
  15. Data show six non-synonymous amino acid or frame shift changes in the KLK3 gene and three changes in each of the neighboring genes, KLK15 and KLK2. PMID: 19823874
  16. The identification of unusual mRNA splice variants of the KLK2 and KLK3 genes that result from inclusion of intronic sequences adjacent to the first exon. PMID: 11834722
  17. Characterization of androgen receptor and nuclear receptor co-regulator expression in human breast cancer cell lines exhibiting differential regulation of kallikreins 2 and 3. PMID: 12124798
  18. kallikrein expression in nipple aspirate fluid- ethnic variation PMID: 12209605
  19. Measurements of free prostate specific antigen and hK2 improve on our ability to counsel patients prior to treatment as to their risk of biochemical recurrence PMID: 16152616
  20. An additional serum marker for the detection of prostatic cancer. PMID: 16388506
  21. a role for the KLK2 gene in prostate cancer susceptibility PMID: 17085659
  22. results imply that prostate cancer risk is associated with androgen receptor(AR)-CAG repeat and kallikrein-2 polymorphisms in Indian population but no unambiguous association was observed with PSA and AR-GGN repeat polymorphism PMID: 17257635
  23. role of kallikrein gene 2 and 3 variant SNPs in the etiology of prostate cancer among men of European ancestry PMID: 17593395
  24. %fPSA and hK2 add important predictive value in older men and much closer to diagnosis PMID: 17657743
  25. The two novel ETV4 fusion partners possess as predominant common characteristics androgen-induction and prostate-specific expression. PMID: 18451133
  26. Recombinant hK2 activates ERK1/2 signaling of prostate cancer cell lines, which express both PAR1 and PAR2. PMID: 18567807
  27. adding free PSA and human kallikrein 2 to standard pretreatment risk-assessment models to predict biochemical recurrence after radical prostatectomy for prostate cancer enhanced the AUC PMID: 19003994
  28. PSA and kallikrein 2 transcripts in the peripheral blood of prostate cancer patients during barchytherapy could serve as a predictor of biochemiacl outcome. PMID: 19434652
  29. Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator) PMID: 19223501

Show More

Hide All

Protein Families
Peptidase S1 family, Kallikrein subfamily
Database Links

HGNC: 6363

OMIM: 147960

KEGG: hsa:3817

STRING: 9606.ENSP00000313581

UniGene: Hs.515560

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*