Recombinant Human Ketohexokinase(KHK)

Code CSB-EP012157HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P50053
Relevance Catalyzes the phosphorylation of the ketose sugar fructose to fructose-1-phosphate.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Hepatic fructokinase
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
Research Area Signal Transduction
Source E.coli
Gene Names KHK
Protein Names Recommended name: Ketohexokinase EC= 2.7.1.3Alternative name(s): Hepatic fructokinase
Expression Region 1-298aa
Tag Info N-terminal GST-tagged
Mol. Weight 59.7kDa
Protein Description Full Length of Isoform 2
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the phosphorylation of the ketose sugar fructose to fructose-1-phosphate.
Involvement in disease Fructosuria (FRUCT)
Protein Families Carbohydrate kinase PfkB family
Tissue Specificity Most abundant in liver, kidney, gut, spleen and pancreas. Low levels also found in adrenal, muscle, brain and eye.
Database Links

HGNC: 6315

OMIM: 229800

KEGG: hsa:3795

STRING: 9606.ENSP00000260598

UniGene: Hs.567297

Related Products

KHK Antibodies

KHK Antibodies for Homo sapiens (Human)

KHK Antibodies for Human

KHK Proteins

KHK Proteins for Homo sapiens (Human)

KHK ELISA Kit

KHK ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.