Recombinant Human Ketohexokinase (KHK)

In Stock
Code CSB-EP012157HU
Abbreviation Recombinant Human KHK protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
KHK
Uniprot No.
Research Area
Signal Transduction
Alternative Names
EC 2.7.1.3; Fructokinase; Hepatic fructokinase; Ketohexokinase; Ketohexokinase isoform a; KHK; KHK_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-298aa
Target Protein Sequence
MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
59.7kDa
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Advance your signal transduction research with our high-quality Recombinant Human KHK protein, an enzyme that plays a pivotal role in the metabolism of fructose. Ketohexokinase (KHK) is primarily expressed in the liver, where it catalyzes the first step of fructose metabolism by phosphorylating fructose to fructose-1-phosphate. With its critical involvement in carbohydrate metabolism, KHK is essential for maintaining proper energy balance and glucose homeostasis in the body.

Our Recombinant Human KHK protein encompasses the full length of isoform 2 (1-298 amino acids) and is expressed in E. coli for consistent, reliable production. The N-terminal GST-tag guarantees efficient purification and detection without interfering with the protein's native structure or biological function. With a purity of greater than 90% as determined by SDS-PAGE, our Recombinant Human KHK protein ensures the quality and consistency required for your signal transduction research. Choose between liquid or lyophilized powder forms to meet your experimental needs.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the phosphorylation of the ketose sugar fructose to fructose-1-phosphate.
Gene References into Functions
  1. Data indicate metabolic enzymes NAD kinase and ketohexokinase as candidate metabolic gene targets, and the chromatin remodeling protein INO80C as a tumor suppressor in KRAS(MUT) colorectal tumor xenograft. PMID: 28954733
  2. Angelica archangelica, Garcinia mangostana, Petroselinum crispum, and Scutellaria baicalensis were the top four botanical candidiates identified with inhibitory activity against ketohexokinase-C. PMID: 27322374
  3. compared with normal hepatocytes, hepatocellular carcinoma (HCC) cells markedly reduce the rate of fructose metabolism and the level of reactive oxygen species, as a result of a c-Myc-dependent and heterogeneous nuclear ribonucleoprotein (hnRNP) H1- and H2-mediated switch from expression of the high-activity fructokinase (KHK)-C to the low-activity KHK-A isoform. PMID: 27088854
  4. myocardial hypoxia actuates fructose metabolism in human and mouse models of pathological cardiac hypertrophy through hypoxia-inducible factor 1alpha (HIF1alpha) activation of SF3B1 and SF3B1-mediated splice switching of KHK-A to KHK-C PMID: 26083752
  5. These studies identify fructokinase as a novel mediator of diabetic nephropathy and document a novel role for endogenous fructose production, or fructoneogenesis, in driving renal disease. PMID: 24876114
  6. This study determined if single nucleotide polymorphisms in genes involved in fructose transport,SLC2A2 and SLC2A5 and metabolism, etohexokinase affect inter-individual variability in metabolic phenotypes. PMID: 23341889
  7. In human hepatocytes uric acid up-regulates KHK expression thus leading to the amplification of the lipogenic effects of fructose. PMID: 23112875
  8. ketohexokinase-A serves an unknown physiologic function that remains intact in essential fructosuria. PMID: 12941785
  9. The expression of ketohexokinase is diminished in human clear cell type of renal cell carcinoma PMID: 16372272
  10. Ketohexokinase-dependent metabolism of fructose induces proinflammatory mediators in proximal tubular cells. PMID: 19158351
  11. The structure of the KHK-A ternary complex revealed an active site with fructose & the ATP analogue in positions ready for phosphorylation. The effects of the pathogenic mutations Gly40Arg & Ala43Thr have been modelled in the context of the KHK structure. PMID: 19237742

Show More

Hide All

Involvement in disease
Fructosuria (FRUCT)
Protein Families
Carbohydrate kinase PfkB family
Tissue Specificity
Most abundant in liver, kidney, gut, spleen and pancreas. Low levels also found in adrenal, muscle, brain and eye.
Database Links

HGNC: 6315

OMIM: 229800

KEGG: hsa:3795

STRING: 9606.ENSP00000260598

UniGene: Hs.567297

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*