Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
EC 2.7.1.3; Fructokinase; Hepatic fructokinase; Ketohexokinase; Ketohexokinase isoform a; KHK; KHK_HUMAN
Species
Homo sapiens (Human)
Expression Region
1-298aa
Target Protein Sequence
MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Advance your signal transduction research with our high-quality Recombinant Human KHK protein, an enzyme that plays a pivotal role in the metabolism of fructose. Ketohexokinase (KHK) is primarily expressed in the liver, where it catalyzes the first step of fructose metabolism by phosphorylating fructose to fructose-1-phosphate. With its critical involvement in carbohydrate metabolism, KHK is essential for maintaining proper energy balance and glucose homeostasis in the body.
Our Recombinant Human KHK protein encompasses the full length of isoform 2 (1-298 amino acids) and is expressed in E. coli for consistent, reliable production. The N-terminal GST-tag guarantees efficient purification and detection without interfering with the protein's native structure or biological function. With a purity of greater than 90% as determined by SDS-PAGE, our Recombinant Human KHK protein ensures the quality and consistency required for your signal transduction research. Choose between liquid or lyophilized powder forms to meet your experimental needs.
