Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

KHK

Uniprot No.

P50053

Research Area

Signal Transduction

Alternative Names

EC 2.7.1.3; Fructokinase; Hepatic fructokinase; Ketohexokinase; Ketohexokinase isoform a; KHK; KHK_HUMAN

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-298aa

Target Protein Sequence

MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

59.7kDa

Protein Length

Full Length of Isoform 2

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Advance your signal transduction research with our high-quality Recombinant Human KHK protein, an enzyme that plays a pivotal role in the metabolism of fructose. Ketohexokinase (KHK) is primarily expressed in the liver, where it catalyzes the first step of fructose metabolism by phosphorylating fructose to fructose-1-phosphate. With its critical involvement in carbohydrate metabolism, KHK is essential for maintaining proper energy balance and glucose homeostasis in the body.

Our Recombinant Human KHK protein encompasses the full length of isoform 2 (1-298 amino acids) and is expressed in E. coli for consistent, reliable production. The N-terminal GST-tag guarantees efficient purification and detection without interfering with the protein's native structure or biological function. With a purity of greater than 90% as determined by SDS-PAGE, our Recombinant Human KHK protein ensures the quality and consistency required for your signal transduction research. Choose between liquid or lyophilized powder forms to meet your experimental needs.

Target Background

Function

Catalyzes the phosphorylation of the ketose sugar fructose to fructose-1-phosphate.

Gene References into Functions

Data indicate metabolic enzymes NAD kinase and ketohexokinase as candidate metabolic gene targets, and the chromatin remodeling protein INO80C as a tumor suppressor in KRAS(MUT) colorectal tumor xenograft. PMID: 28954733
Angelica archangelica, Garcinia mangostana, Petroselinum crispum, and Scutellaria baicalensis were the top four botanical candidiates identified with inhibitory activity against ketohexokinase-C. PMID: 27322374
compared with normal hepatocytes, hepatocellular carcinoma (HCC) cells markedly reduce the rate of fructose metabolism and the level of reactive oxygen species, as a result of a c-Myc-dependent and heterogeneous nuclear ribonucleoprotein (hnRNP) H1- and H2-mediated switch from expression of the high-activity fructokinase (KHK)-C to the low-activity KHK-A isoform. PMID: 27088854
myocardial hypoxia actuates fructose metabolism in human and mouse models of pathological cardiac hypertrophy through hypoxia-inducible factor 1alpha (HIF1alpha) activation of SF3B1 and SF3B1-mediated splice switching of KHK-A to KHK-C PMID: 26083752
These studies identify fructokinase as a novel mediator of diabetic nephropathy and document a novel role for endogenous fructose production, or fructoneogenesis, in driving renal disease. PMID: 24876114
This study determined if single nucleotide polymorphisms in genes involved in fructose transport,SLC2A2 and SLC2A5 and metabolism, etohexokinase affect inter-individual variability in metabolic phenotypes. PMID: 23341889
In human hepatocytes uric acid up-regulates KHK expression thus leading to the amplification of the lipogenic effects of fructose. PMID: 23112875
ketohexokinase-A serves an unknown physiologic function that remains intact in essential fructosuria. PMID: 12941785
The expression of ketohexokinase is diminished in human clear cell type of renal cell carcinoma PMID: 16372272
Ketohexokinase-dependent metabolism of fructose induces proinflammatory mediators in proximal tubular cells. PMID: 19158351
The structure of the KHK-A ternary complex revealed an active site with fructose & the ATP analogue in positions ready for phosphorylation. The effects of the pathogenic mutations Gly40Arg & Ala43Thr have been modelled in the context of the KHK structure. PMID: 19237742

Hide All

Involvement in disease

Fructosuria (FRUCT)

Protein Families

Carbohydrate kinase PfkB family

Tissue Specificity

Most abundant in liver, kidney, gut, spleen and pancreas. Low levels also found in adrenal, muscle, brain and eye.

Database Links

HGNC: 6315

OMIM: 229800

KEGG: hsa:3795

STRING: 9606.ENSP00000260598

UniGene: Hs.567297

Code	CSB-EP012157HU
Abbreviation	Recombinant Human KHK protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Ketohexokinase (KHK)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage