Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
KIAA0136; Microrchidia 3; MORC family CW type zinc finger 3; MORC family CW type zinc finger protein 3; MORC family CW-type zinc finger protein 3; MORC3; MORC3_HUMAN; Nuclear matrix protein 2; Nuclear matrix protein NXP2; NXP2; ZCW5; ZCWCC3; Zinc finger CW type coiled coil domain 3; Zinc finger CW type coiled coil domain protein 3; Zinc finger CW type with coiled coil domain 3; Zinc finger CW-type coiled-coil domain protein 3
Species
Homo sapiens (Human)
Expression Region
1-290aa
Target Protein Sequence
MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Recombinant Human MORC3 protein is expertly crafted to facilitate your research needs. This high-quality, partial protein (1-290aa) is expressed in E. coli and comes with an N-terminal 6xHis-SUMO-tag, ensuring easy purification and detection. With a purity of greater than 90% as confirmed by SDS-PAGE, our MORC3 protein offers reliable and consistent results.
Investigate the complex world of MORC family CW-type zinc finger proteins and their functions with our advanced recombinant protein. Available in both liquid and lyophilized powder forms, our Recombinant Human MORC3 protein is a versatile and valuable addition to your research toolkit.
