Recombinant Human Metallothionein-3(MT3)

In Stock
Code CSB-EP015122HUe0
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P25713
Lead Time 3-7 business days
Relevance Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias GIFB
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
Research Area Neuroscience
Source E.coli
Gene Names MT3
Expression Region 1-68aa
Tag Info N-terminal GST-tagged
Mol. Weight 33.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.
Protein Families Metallothionein superfamily, Type 1 family
Tissue Specificity Abundant in a subset of astrocytes in the normal human brain, but greatly reduced in the Alzheimer disease (AD) brain.
Database Links

HGNC: 7408

OMIM: 139255

KEGG: hsa:4504

STRING: 9606.ENSP00000200691

UniGene: Hs.73133

Related Products

MT3 Antibodies

MT3 Antibodies for Homo sapiens (Human)

MT3 Antibodies for Human

MT3 Proteins

MT3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.