Recombinant Human Metallothionein-3 (MT3)

In Stock
Code CSB-EP015122HU
Abbreviation Recombinant Human MT3 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
MT3
Uniprot No.
Research Area
Neuroscience
Alternative Names
GIF; GIFB; GRIF; Growth inhibitory factor; Metallothionein 3 (growth inhibitory factor (neurotrophic)); Metallothionein 3; Metallothionein III; Metallothionein-3; Metallothionein-III; Mt 3; MT III; MT-3; MT-III; MT3; MT3_HUMAN; ZnMT3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-68aa
Target Protein Sequence
MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.9kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.
Gene References into Functions
  1. This study suggest that MT3 gene polymorphisms are not associated with autism. PMID: 29524106
  2. In recent years, the roles of zinc dynamics and MT3 function in neurodegeneration are slowly emerging. This short review focuses on the recent developments regarding the chemistry and biology of MT3. [review] PMID: 28538697
  3. C-terminal domain of MT3 confers dome formation in MCF-7 cells and the presence of this domain induces expression of the GAGE family of genes. The differential effects of MT3 and metallothionein 1E on the expression of GAGE genes suggests unique roles of these genes in the development and progression of breast cancer. PMID: 28545470
  4. The expression of MT-3 mRNA in breast cancer cell lines was significantly lower than in the normal human breast epithelial cell line. The results suggest that MT-3 may play a role in the malignant transformation of breast epithelial cells and in tumor progression. PMID: 27840910
  5. The epidermis of human skin and resulting malignancies express high level of MT-3. PMID: 25290577
  6. The study implicates the unique C-terminal sequence of MT-3 in the conversion of HK-2 cells to display an enhanced epithelial phenotype. PMID: 25803827
  7. MT3 may regulate breast cancer cell invasiveness by modulating the expression of MMP3. PMID: 25933064
  8. The presence of MT-3 in the zona glomerulosa of pathological adrenal cortex may imply a role in the pathophysiology of aldosterone-producing tissues. PMID: 24242700
  9. MT-capital I, Ukrainiancapital I, Ukrainiancapital I, Ukrainian increases the amount of active ADAM10 in association with furin, PC7 and PKCalpha. PMID: 24859040
  10. Upregulation of MT-3 gene expression can inhibit esophageal cancer cell proliferation and induce apoptosis. PMID: 24222235
  11. The experiments indicate that MT3 is an androgen-upregulated gene, and promotes tumorigenesis of prostate carcinoma cells. PMID: 23794209
  12. the molecular mechanism for protection against the neuronal cytotoxicity of Abeta(1-42) with copper ions PMID: 23086305
  13. MT-III expression may have an impact on the pathogenesis of non-small cell lung cancer. PMID: 23482768
  14. MT-3 modulates the catalytic redox properties of PrP-Cu(II) PMID: 22615124
  15. Esophageal adenocarcinomas are characterized by frequent epigenetic silencing of MT3. PMID: 21818286
  16. Metallothionein-III is a specific component of glial cytoplasmic inclusions and is upregulated in multiple system atrophy. PMID: 20039155
  17. The roles of zinc and metallothionein-3 in autophagy and/or lysosomal function are reviewed. PMID: 20974010
  18. MT-3 expression is involved in the transport function of a human renal cell line that retains properties of the proximal tubule. PMID: 11849386
  19. Overexpression of human metallothionein-III prevents hydrogen peroxide-induced oxidative stress in human fibroblasts. "metallothionein-III " PMID: 12067712
  20. overexpression can influence the growth and chemotherapeutic drug resistance of the PC-3 prostate cancer cell line PMID: 12111700
  21. Hypermethylation of metallothionein-3 CpG island in gastric carcinoma PMID: 12538345
  22. Metallothionein-III has anticarcinogenic and neuroprotective roles in cells exposed to gamma rays PMID: 15190073
  23. The affect the role of MT3 on cell viability, which may explain in part why the comprehensive effect of MT3 on the cells was elusive. PMID: 16087360
  24. analysis of the epitope of neuronal growth inhibitory factor (GIF) PMID: 16336778
  25. MT3 expression is frequently down-regulated in oesophageal squamous cell carcinoma , by DNA methylation, but that this is not a prognostic indicator PMID: 16351731
  26. mutation of MT3 at Glu23 may alter the NO metabolism and/or affect zinc homeostasis in brain, thus altering the neuronal growth inhibitory activity PMID: 16945328
  27. The alpha-domain is indispensable and plays an important role in modulating the stability of the metal cluster in the beta-domain by domain-domain interactions, thus influencing the bioactivity of hMT3. PMID: 17712581
  28. The level of MT-3 expression in human proximal tubular cells influences transepithelial resistance and cadherin expression but does not the Cd(+2)-induced loss of vectorial active transport. PMID: 18182399
  29. MT-3 is a highly hypoxia-inducible gene in human adipocytes; the protein may protect adipocytes from hypoxic damage PMID: 18206644
  30. These results suggest that MT-III upregulates VEGF production in brain endothelial cells by a HIF-1alpha-dependent mechanism. PMID: 18295594
  31. The structure adopted by the (6)CPCP(9) motif is the determinant factor of the inhibitory bioactivity of hGIF; but residues within the N-terminal fragment may also influence the peptide conformation and contribute to the protein's bioactivity. PMID: 18533104
  32. Metallothionein-III-induced activation of phosphatidylinositol 3-kinase/Akt and extracellular signal-regulated kinase1/2 up-regulates expression and activity of heme oxygenase-1, which provides protection against oxidative damage in dopaminergic cells. PMID: 18554677
  33. the bioactivity of hGIF is mainly related to the essential metal release and its characteristic conformation. PMID: 18757100
  34. metallothionein in decidual cells seems to be responsible for the proper coexistence between decidual cells and activated immune cells that infiltrate both eutopic and ectopic decidua during cesarean section and placental abruption PMID: 18782281
  35. In this study, the binding of Zn(2+), Ca(2+), and Mg(2+) to human Zn(7)MT-3 and its mutant lacking an acidic hexapeptide insert, Zn(7)MT-3(Delta55-60), was investigated and compared with the binding of Zn(7)MT-2. PMID: 19425569
  36. Results provide information on the domain-domain interaction at the molecular level, and shed new light on the mechanism of the bioactivity of human neuronal growth inhibitory factor. PMID: 19490120
  37. study of reaction/binding of cisplatin and transplatin with MT-3 and MT-2 initially bound with zinc; study includes kinetics and stoichiometry of the reactions PMID: 19536566
  38. weak in pancreatic serous cystadenomas; increased expressions in adenomocarcinomas; potential prognostic marker PMID: 19578815

Show More

Hide All

Protein Families
Metallothionein superfamily, Type 1 family
Tissue Specificity
Abundant in a subset of astrocytes in the normal human brain, but greatly reduced in the Alzheimer disease (AD) brain.
Database Links

HGNC: 7408

OMIM: 139255

KEGG: hsa:4504

STRING: 9606.ENSP00000200691

UniGene: Hs.73133

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*