Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-YP016063HU |
| Size | $694 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
The gene fragment corresponding to the 1-598aa of the human NR4A2 protein was synthesized, with appropriate restriction sites suitable for in-frame cloning into an expression vector, with N-terminal 6xHis tag. The yeast was transfected with the expression vector, and the clone was expressed upon certain induction. After the induced cell centrifugation, the recombinant protein was purified from the cell extract and presented as N-terminal 6xHis-tagged fusion. This recombinant human NR4A2 protein's purity is greater than 90% assayed by SDS-PAGE. The NR4A2 protein ran to a band of about 55 kDa molecular weight on the gel. Nuclear Receptor 4A2 (NR4A2/NURR1) belongs to the member of the steroid-thyroid hormone-retinoid receptor superfamily. NR4A2 mutations can cause intellectual disability and language impairment with persistent Dystonia-Parkinsonism. In addition, NR4A2 regulates autophagy and chemoresistance in pancreatic ductal adenocarcinoma. Also, misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. De novo variants of NR4A2 are associated with neurodevelopmental disorder and epilepsy. Genome-Wide analysis identifies NURR1-Controlled network of new synapse formation and cell cycle arrest in human neural stem cells. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | NR4A2 |
| Uniprot No. | P43354 |
| Research Area | Cancer |
| Alternative Names |
HZF 3; HZF3; Immediate-early response protein NOT; Intermediate early receptor protein; NGFI B/nur77 beta type transcription factor homolog; NOT; Nr4a2; NR4A2_HUMAN; nuclear receptor of T cells; nuclear receptor related 1; Nuclear receptor subfamily 4 group A member 2; Nur related protein 1 homolog; nur related protein-1; human homolog of; Nurr 1; Orphan nuclear receptor NR4A2; Orphan nuclear receptor NURR1; RNR 1; RNR1; T cell nuclear receptor NOT; T-cell nuclear receptor NOT; TINUR; Transcriptionally inducible nuclear receptor; Transcriptionally inducible nuclear receptor related ; Transcriptionally inducible nuclear receptor related 1; Transcriptionally-inducible nuclear receptor
|
| Species | Homo sapiens (Human) |
| Source | Yeast |
| Expression Region | 1-598aa |
| Target Protein Sequence | MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 68.6 kDa |
| Protein Length | Full Length |
| Tag Info |
N-terminal 6xHis-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons.
|
| Gene References into Functions |
|
| Subcellular Location | Cytoplasm. Nucleus. Note=Mostly nuclear; oxidative stress promotes cytoplasmic localization. |
| Protein Families | Nuclear hormone receptor family, NR4 subfamily |
| Tissue Specificity | Expressed in a number of cell lines of T-cell, B-cell and fibroblast origin. Strong expression in brain tissue. |
| Database Links |
HGNC: 7981 OMIM: 601828 KEGG: hsa:4929 STRING: 9606.ENSP00000344479 UniGene: Hs.563344 |
