Recombinant Human Nuclear receptor subfamily 4 group A member 2(NR4A2)

In Stock
Code CSB-YP016063HU
Size US$694Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names NR4A2
Uniprot No. P43354
Research Area Cancer
Alternative Names HZF 3; HZF3; Immediate-early response protein NOT; Intermediate early receptor protein; NGFI B/nur77 beta type transcription factor homolog; NOT; Nr4a2; NR4A2_HUMAN; nuclear receptor of T cells; nuclear receptor related 1; Nuclear receptor subfamily 4 group A member 2; Nur related protein 1 homolog; nur related protein-1; human homolog of; Nurr 1; Orphan nuclear receptor NR4A2; Orphan nuclear receptor NURR1; RNR 1; RNR1; T cell nuclear receptor NOT; T-cell nuclear receptor NOT; TINUR; Transcriptionally inducible nuclear receptor; Transcriptionally inducible nuclear receptor related ; Transcriptionally inducible nuclear receptor related 1; Transcriptionally-inducible nuclear receptor
Species Homo sapiens (Human)
Source Yeast
Expression Region 1-598aa
Target Protein Sequence MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 68.6 kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons (By similarity).
Gene References into Functions
  1. PARP1 inhibitor also suppressed the aldosterone secretion in response to the angiotensin II. Together, these results suggest PARP1 is a prime coregulator for Nurr1. PMID: 29738496
  2. Data expand the understanding of the mechanism by which the NR4A2 nuclear receptor can facilitate DNA DSB repair. PMID: 28607006
  3. An association was identified in a Mexican population between genotype and mRNA expression levels of NR4A2 in patients with Parkinson's disease. PMID: 28716280
  4. miR-34 was identified as a direct negative regulator of NR4A2. A novel regulatory network linking p53, miR-34, and NR4A2 was revealed, in which p53 can overcome its inhibition by endogenous NR4A2 through upregulating miR-34. PMID: 27121375
  5. Nurr1 was induced during intestinal regeneration after I/R injury. Nurr1 promoted proliferation of intestinal epithelial cells after H/R injury. Nurr1 inhibited p21 expression in a p53-independent manner. Nurr1 inhibited p21 gene transcription by binding to p21 promoter directly. PMID: 27553040
  6. Our findings of a de novo deletion of NR4A2 in an individual with mild intellectual disability and prominent speech and language impairment provides further evidence for NR4A2 haploinsufficiency being causative for neurodevelopmental and particularly language phenotypes PMID: 28544326
  7. NR4A sub-family of nuclear orphan receptors (Nor-1, Nurr-1 and Nur-77) may have a role in trophoblastic cell differentiation. PMID: 28808448
  8. this study shows over-expression of NR4A2 mRNA in peripheral CD4+ T cells of Sjogren's syndrome patients PMID: 28621822
  9. NR4A2 and NR4A3 are components of a downstream transcriptional response to PKA activation in the neutrophil, and that they positively regulate neutrophil survival and homeostasis. PMID: 28637666
  10. Study found a marked down-regulated gene expression of the NR4A subfamily (NR4A1, NR4A2, and NR4A3) obtained from Parkinson's disease patients, but only a NR4A1 decrease in Alzheimer's disease patients compared to healthy controls. This study reports that the entire NR4A subfamily and not only NR4A2 could be systemically involved in Parkinson's disease. PMID: 27159982
  11. show that unsaturated fatty acids also interact with the Nurr1 LBD, and solution NMR spectroscopy reveals the binding epitope of DHA at its putative ligand-binding pocket PMID: 27128111
  12. NURR1 is an essential transcription factor for the differentiation, maturation, and maintenance of midbrain dopaminergic neurons. PMID: 26678495
  13. Nurr1 overexpression exerts neuroprotective and anti-inflammatory roles via down-regulating CCL2 in both in vivo and in vitro Parkinson's disease models, contributing to developing mechanism-based and neuroprotective strategies against PD PMID: 27940361
  14. In the PPI network, genes may be involved in Down syndrome (DS) by interacting with others, including nuclear receptor subfamily 4 group A member 2 (NR4A2)early growth response (EGR)2 and NR4A2EGR3. Therefore, RUNX1, NR4A2, EGR2, EGR3 and ID4 may be key genes associated with the pathogenesis of DS. PMID: 27667480
  15. Our results suggest that NLK inhibits transcriptional activation of Nurr1 gene by impeding CBP's role as a co-activator of NF-kappaB and CREB in prostate cancer. PMID: 27036119
  16. decreased expression levels of Nurr1 were associated with chronic inflammation and insulin resistance in patients with T2D. PMID: 26239742
  17. The immunohistochemical, qRT-PCR and western blot analyses revealed that Nurr1 expression was increased in gastric cancer tissues compared with normal gastric tissue. PMID: 26022133
  18. NR4A2 is a key factor in multiple diseases, such as inflammation, cancer and cardiovascular diseases. PMID: 25917081
  19. A2M is expressed in the vasculature and NR4A receptors modulate VSMC MMP2/9 activity by several mechanisms including the up-regulation of A2M. PMID: 25809189
  20. In this review, a concise overview of the current understanding of the important metabolic roles governed by NR4A members NR4A1, NR4A2 and NR4A3 including their participation in a number of diseases shall be provided PMID: 25089663
  21. Data show that some rexinoids display selective coactivator (CoA) recruitment by the retinoid X receptors (RXRs) homodimer and by the heterodimers nuclear receptor Nur77/RXR and Nurr1/RXR. PMID: 26148973
  22. Thus our data identify a previously unknown role for Nr4a2 in the regulation of macrophage polarization. PMID: 25953901
  23. The results failed to reveal significant link between NR4A2 polymorphism and schizophrenia risk. [META-ANALYSIS] PMID: 25982322
  24. Because the phosphorylation site mutants of NR4A2 cannot rescue the cell death-promoting activity, ASK1-p38 pathway-dependent phosphorylation and subsequent cytoplasmic translocation of NR4A2 may be required for oxidative stress-induced cell death. PMID: 25752609
  25. gestational diabetes mellitus, but not pre-existing maternal obesity, associated with increased placental expression PMID: 25199433
  26. NURR1 upregulation by tissue-type plasminogen activator during ischemic stroke is associated with endothelial dysfunction and inflammation. PMID: 25503547
  27. High cytoplasmic expression of NR4A2 is a potential unfavorable prognostic factor for patients with nasopharyngeal carcinoma. PMID: 23803035
  28. The AngII-NGFIB/NURR1 pathway controls HSD3B1 expression. PMID: 25092869
  29. our data demonstrate that key midbrain dopamine regulators (Nurr1, Pitx3, and Lmx1a) play overlapping as well as distinct roles during neurogenesis and neurotransmitter phenotype determination of mDA neurons PMID: 24172139
  30. The current review describes the role of two such factors, Nurr1 and engrailed, in differentiation, maturation, and in normal physiological functions including acquisition of neurotransmitter identity. PMID: 24685177
  31. Data indicate that expression of Nurr1 was significantly induced by 1,1-bis(3'-indolyl)-1-(p-chlorophenyl methane) (DIM-D). PMID: 23950896
  32. A novel role for the NR4A2 nuclear receptors as direct facilitators of nucleotide excision repair. PMID: 24223135
  33. The results of this study suggest a protective and anti-inflammatory role of NR4A2 and TNFAIP3, both being under-regulated in monocytes and CD4 + T cells of MS patients PMID: 24852325
  34. NR4A2 is regulated by gastrin and influences cellular responses of gastric adenocarcinoma cells. PMID: 24086717
  35. High NR4A2 expression in gastric cancer cells confers chemoresistance, attenuates 5-fluorouracil-induced apoptosis, and predicts an unfavorable survival, especially for those who received chemotherapy. PMID: 23821160
  36. Bioinformatic and deletion studies identified a 5' region of the TSP-1 promoter repressed by NR4A2 and proangiogenic transcription factors, including NF-kappaB and Ets1/2. PMID: 23933487
  37. Nurr1 overexpression significantly increased the SIRT1 occupancy of the consensus elements for Nurr1 binding hTH promoter region. PMID: 23977047
  38. NR4A nuclear receptors are involved in negative selection of thymocytes, Treg differentiation and the development of Ly6C monocytes. Nur77 and Nurr1 attenuate atherosclerosis in mice whereas NOR-1 aggravates vascular lesion formation. PMID: 24005216
  39. High nurr1 is associated with progression of prostate cancer PMID: 23679312
  40. in human melanoma HMV-II cells both CRF and Ucn1 regulate TRP1 gene expression via Nurr-1/Nur77 production, independent of pro-opiomelanocortin or alpha-melanocyte-stimulating hormone stimulation. PMID: 23416839
  41. High expression of NR4A2 in CRC cells confers chemo-resistance, attenuates chemotherapeutics-induced apoptosis, and predicts unfavorable prognosis of colon cancer patients. PMID: 23809767
  42. Recessive genotypes of rs1150143, rs1150144, rs834830, and rs707132 were associated with a worse sustained attention task performance in schizophrenic males, but not females. Males with the GGGTG haplotype had poorer performance. PMID: 22294735
  43. NURR1 function presents a dichotomy in breast cancer etiology, in which NURR1 expression is associated with normal breast epithelial differentiation and efficacy of systemic cancer therapy. PMID: 23517088
  44. PIASgamma fully represses Nurr1 transactivation through a direct interaction, independently of its E3-ligase activity PMID: 23358114
  45. Collectively, our results suggest that NR4A2 may be a susceptibility gene for Parkinson's disease in the Chinese population PMID: 22827504
  46. Nurr1 shuttling between the cytosol and nucleus is controlled by specific nuclear import and export signals PMID: 23283970
  47. Nur-related receptor 1 gene polymorphisms are implicated in alcohol dependence in Mexican Americans PMID: 23066323
  48. Data show altered adipose tissue expression of the NURR1 stress-responsive nuclear receptor in obesity, suggesting it may modulate pathogenic potential in humans. PMID: 22143616
  49. Pin1 enhances the transcriptional activity of all three NR4A nuclear receptors and increases protein stability of Nur77 through inhibition of its ubiquitination. PMID: 22789442
  50. analysis of Nurr1 gene expression in electrically-stimulated human MSCs and the induction of neurogenesis PMID: 22800541
  51. INFS/Nurr1 nuclear partnership provides a novel mechanism for TH gene regulation in mDA neurons and a potential therapeutic target in neurodevelopmental and neurodegenerative disorders. PMID: 22514272
  52. alpha-Synuclein-mediated suppression of transgenic Nurr1 protein overexpression contributes to the vulnerability of midbrain dopaminergic neurons in a model of Parkinson's disease pathogenesis. PMID: 22764233
  53. NR4A2 is a downstream mediator of TNFalpha signaling in synovial tissue. NR4A2 transcriptional activity contributes to the hyperplastic and invasive phenotype of synoviocytes that leads to cartilage destruction. PMID: 22275273
  54. This study provided that NURR1 and PITX3 gene expression is decreased in the peripheral blood lymphocytes of Chinese patients with Parkinson's disease patients. PMID: 22309633
  55. Moracenin D protected against dopamine-induced cell death by up-regulation of nurr1 and down-regulation of alpha-synuclein mRNA levels. PMID: 21936000
  56. Data suggest that DJ-1 upregulates tyrosine hydroxylase expression by activating its transcription factor Nurr1 via the ERK1/2 pathway. PMID: 22024154
  57. Nur77 and Nurr1 promote fetal bone marrow mesenchymal stromal cells migration. PMID: 21480782
  58. Association of nuclear receptor related 1 protein (Nurr1) haplotypes to the restenosis/re-occlusion rate after femoropopliteal percutaneous transluminal angioplasty was investigated. PMID: 22230598
  59. NR4A functions directly at DNA repair sites by a process that requires phosphorylation by DNA-PK PMID: 21979916
  60. Forced expression of retinoic X receptor (RXR)alpha with Nurr1 remarkably reduces Nurr1 activity in tyrosine hydroxylase (TH)-positive dopaminergic neuronal stem cells, significantly down-regulating TH promoter activity. PMID: 22066143
  61. we have identified a molecular signature associated with potential cancer stem cells and showed for the first time the existence of a functional relationship between CD133, endothelin-1 and NR4A2 expression in colon cancer cells. PMID: 21826669
  62. stimulation of peripheral blood mast cells caused a robust upregulation of NR4A2 and, in particular, NR4A3, while NR4A1 expression was only moderately affected PMID: 21621845
  63. NR4A2 plays a key role as a transcriptional integration point between the eicosanoid and fatty acid metabolic pathways PMID: 21757690
  64. NR4A2 was found to have bimodal expression in human skeletal muscle tissue. PMID: 21299892
  65. Results propose a MIF-NURR1 signaling axis as a regulator of the glucocorticoid sensitivity of MKP1. PMID: 20829434
  66. We show here that Foxa2, a forkhead transcription factor whose role in midbrain DA neuron development was recently revealed, synergistically cooperates with Nurr1 to induce a DA phenotype, midbrain-specific gene expression, and neuronal maturation. PMID: 20049900
  67. Nurr1 haplotypes are associated with human restenosis risk, and Nurr1 is expressed in human in-stent restenosis PMID: 20421523
  68. Study of conditional gene ablation in trangenic mice shows that disrupted function of Nurr1 and other developmental transcription factors may contribute to neurodegenerative disease. PMID: 20016108
  69. FABP5 could be a regulated target of Nurr1. PMID: 19861119
  70. The result suggests that the c.-469delG and possibly other variants of the NR4A2 gene may be of relevance to the complex factors involved in the pathogenesis of schizophrenia. PMID: 11803525
  71. may contribute to susceptibility to alcoholism. PMID: 11840500
  72. NURR1 induction by proinflammatory mediators represents a point of convergence of at least two distinct signaling pathways, suggesting an important common role for this transcription factor in mediating multiple inflammatory signals. PMID: 11884470
  73. A homozygous polymorphism has been found in intron 6 of Nurr1 gene, which was significantly higher in Parkinson's subjects compared to control. PMID: 11914402
  74. Decreased expression of the transcription factor NURR1 in dopamine neurons of cocaine abusers PMID: 11959923
  75. Mutations in NR4A2 associated with familial Parkinson disease PMID: 12496759
  76. Nurr1, NGFI-B and NOR-1 mRNA are expressed constitutively in various human neural and non-neural cell lines, and their levels are up-regulated in human neurons by activation of protein kinase A or protein kinase C pathway. PMID: 12564761
  77. Data do not support the notion that the NR4A2 gene plays a major role in risk for schizophrenia among Japanese individuals. PMID: 12627459
  78. Nurr1 may play a direct role for specification of DA neurotransmitter identity by activating TH gene transcription in a cell context-dependent manner PMID: 12694388
  79. The common heterozygous NI6P is associated with an increased risk of Parkinson disease and an association of borderline significance was found for the homozygous NI6P and diffuse Lewy body disease. PMID: 12756136
  80. crystal structure of the orphan receptor Nurr1 at 2.2 A resolution; structure-activity relationship PMID: 12774125
  81. NURR1 promoter polymorphisms were studied in Parkinson's disease (PD), schizophrenia (SZ), and personality traits and found unlikely to be involved in conferring susceptibility for SZ or PD. PMID: 12815740
  82. Point mutations in exon 1 are not major cause of familial Parkinson disease PMID: 12827450
  83. NURR1 is a nuclear receptor which can assume an active conformation in the absence of a ligand agonist. PMID: 12852843
  84. The genes identified here are novel candidates as key early mediators of VEGF-induced endothelial functions. PMID: 14525795
  85. Nurr1 activates the OPN promoter directly in osteoblastic cells and may have a role in the regulation of bone homeostasis PMID: 14988426
  86. NR4A2 (A NEWLY DISCOVERED MUTANT GENE)IS A MEMBER OF A NUCLEAR RECEPTOR SUPERFAMILY REQUIRED FOR THE DIFFERENTIATION AND MAINTENANCE OF NIGRAL DOPAMINERGIC NEURONS. LOCATION 2Q22-23(P.81) PMID: 15018843
  87. To evaluate the role of NR4A2 in PD, exon 1 was analyzed in 108 families with apparent autosomal dominant PD. None of the previously described mutations were found by sequence analysis of the 481 bp fragment of exon 1; no new sequence variants were found. PMID: 15184637
  88. Polymorphic variant within intron 6 of the Nurr1 gene was reported to be associated with familial Parkinson disease. PMID: 15197702
  89. search for all known mutations in 176 Caucasian Portuguese and 82 Caucasian Brazilian subjects with lifetime diagnosis of schizophrenia failed to identify any of the described mutations in patients or controls PMID: 15211629
  90. Expression of Nurr1 and NGFI-B plays an important role in human adrenal cortex and its neoplasms, including possible regulation of steroidogenesis. PMID: 15292355
  91. Virtually all striatal cells that stain for tyrosine hydroxylase also express Nurr1, confirming the existence of dopaminergic neurons intrinsic to the human striatum. PMID: 15450088
  92. Causal relationship between the rapid decline of aromatase mRNA and induction of orphan nuclear receptors NURR1 and NGFI-B expression, which concomitantly occur upon LH surge at the later stages of ovarian follicular development. PMID: 15486232
  93. down-regulation of NR4A2 as well as NR4A1 promoted intrinsic apoptosis PMID: 15548686
  94. NR4A nuclear receptors NR4A1, NR4A2, NR4A3 are potential transcriptional mediators of inflammatory signals in activated macrophages PMID: 15964844
  95. NR4A2 can stimulate progression of colorectal cancer downstream from cyclooxygenase 2-derived PGE2. PMID: 16293616
  96. In Parkinsons, Nurr1 was decreased in nigral neurons containing alpha-synuclein-immunoreactive inclusions. In Alzheimer's, Nurr1 was decreased in neurons containing neurofibrillary tangles. In PSP, Nurr1 was also decreased. PMID: 16320253
  97. Nurr1 and Pitx3 cooperatively promote terminal maturation to the midbrain dopamine neuron phenotype in murine and human ES cell cultures. PMID: 16477036
  98. Nur77, Nurr1, and NOR-1 are expressed in human atherosclerotic lesion macrophages and reduce human macrophage lipid loading and inflammatory responses, providing further evidence for a protective role of these factors in atherogenesis. PMID: 16873729
  99. Insights into the mechanisms of transcription via the Nurr1 LBD identifies an alternative co-activator-binding surface that is unique to the NR4A family of NRs. PMID: 17032747
  100. Nurr1 has a protective function in cartilage homeostasis by selectively repressing matrix metalloproteinase gene expression during inflammation. PMID: 17283078

Show More

Hide All

Subcellular Location Cytoplasm, Nucleus
Protein Families Nuclear hormone receptor family, NR4 subfamily
Tissue Specificity Expressed in a number of cell lines of T-cell, B-cell and fibroblast origin. Strong expression in brain tissue.
Database Links

HGNC: 7981

OMIM: 601828

KEGG: hsa:4929

STRING: 9606.ENSP00000344479

UniGene: Hs.563344

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1