Recombinant Human Nuclear receptor subfamily 4 group A member 2 (NR4A2)

In Stock
Code CSB-YP016063HU
Abbreviation Recombinant Human NR4A2 protein
MSDS
Size $368
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
NR4A2
Uniprot No.
Research Area
Cancer
Alternative Names
HZF 3; HZF3; Immediate-early response protein NOT; Intermediate early receptor protein; NGFI B/nur77 beta type transcription factor homolog; NOT; Nr4a2; NR4A2_HUMAN; nuclear receptor of T cells; nuclear receptor related 1; Nuclear receptor subfamily 4 group A member 2; Nur related protein 1 homolog; nur related protein-1; human homolog of; Nurr 1; Orphan nuclear receptor NR4A2; Orphan nuclear receptor NURR1; RNR 1; RNR1; T cell nuclear receptor NOT; T-cell nuclear receptor NOT; TINUR; Transcriptionally inducible nuclear receptor; Transcriptionally inducible nuclear receptor related ; Transcriptionally inducible nuclear receptor related 1; Transcriptionally-inducible nuclear receptor
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-598aa
Target Protein Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
68.6 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The gene fragment corresponding to the 1-598aa of the human NR4A2 protein was synthesized, with appropriate restriction sites suitable for in-frame cloning into an expression vector, with N-terminal 6xHis tag. The yeast was transfected with the expression vector, and the clone was expressed upon certain induction. After the induced cell centrifugation, the recombinant protein was purified from the cell extract and presented as N-terminal 6xHis-tagged fusion. This recombinant human NR4A2 protein's purity is greater than 90% assayed by SDS-PAGE. The NR4A2 protein ran to a band of about 55 kDa molecular weight on the gel.

Nuclear Receptor 4A2 (NR4A2/NURR1) belongs to the member of the steroid-thyroid hormone-retinoid receptor superfamily. NR4A2 mutations can cause intellectual disability and language impairment with persistent Dystonia-Parkinsonism. In addition, NR4A2 regulates autophagy and chemoresistance in pancreatic ductal adenocarcinoma. Also, misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. De novo variants of NR4A2 are associated with neurodevelopmental disorder and epilepsy. Genome-Wide analysis identifies NURR1-Controlled network of new synapse formation and cell cycle arrest in human neural stem cells.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons.
Gene References into Functions
  1. PARP1 inhibitor also suppressed the aldosterone secretion in response to the angiotensin II. Together, these results suggest PARP1 is a prime coregulator for Nurr1. PMID: 29738496
  2. Data expand the understanding of the mechanism by which the NR4A2 nuclear receptor can facilitate DNA DSB repair. PMID: 28607006
  3. An association was identified in a Mexican population between genotype and mRNA expression levels of NR4A2 in patients with Parkinson's disease. PMID: 28716280
  4. miR-34 was identified as a direct negative regulator of NR4A2. A novel regulatory network linking p53, miR-34, and NR4A2 was revealed, in which p53 can overcome its inhibition by endogenous NR4A2 through upregulating miR-34. PMID: 27121375
  5. Nurr1 was induced during intestinal regeneration after I/R injury. Nurr1 promoted proliferation of intestinal epithelial cells after H/R injury. Nurr1 inhibited p21 expression in a p53-independent manner. Nurr1 inhibited p21 gene transcription by binding to p21 promoter directly. PMID: 27553040
  6. Our findings of a de novo deletion of NR4A2 in an individual with mild intellectual disability and prominent speech and language impairment provides further evidence for NR4A2 haploinsufficiency being causative for neurodevelopmental and particularly language phenotypes PMID: 28544326
  7. NR4A sub-family of nuclear orphan receptors (Nor-1, Nurr-1 and Nur-77) may have a role in trophoblastic cell differentiation. PMID: 28808448
  8. this study shows over-expression of NR4A2 mRNA in peripheral CD4+ T cells of Sjogren's syndrome patients PMID: 28621822
  9. NR4A2 and NR4A3 are components of a downstream transcriptional response to PKA activation in the neutrophil, and that they positively regulate neutrophil survival and homeostasis. PMID: 28637666
  10. Study found a marked down-regulated gene expression of the NR4A subfamily (NR4A1, NR4A2, and NR4A3) obtained from Parkinson's disease patients, but only a NR4A1 decrease in Alzheimer's disease patients compared to healthy controls. This study reports that the entire NR4A subfamily and not only NR4A2 could be systemically involved in Parkinson's disease. PMID: 27159982
  11. show that unsaturated fatty acids also interact with the Nurr1 LBD, and solution NMR spectroscopy reveals the binding epitope of DHA at its putative ligand-binding pocket PMID: 27128111
  12. NURR1 is an essential transcription factor for the differentiation, maturation, and maintenance of midbrain dopaminergic neurons. PMID: 26678495
  13. Nurr1 overexpression exerts neuroprotective and anti-inflammatory roles via down-regulating CCL2 in both in vivo and in vitro Parkinson's disease models, contributing to developing mechanism-based and neuroprotective strategies against PD PMID: 27940361
  14. In the PPI network, genes may be involved in Down syndrome (DS) by interacting with others, including nuclear receptor subfamily 4 group A member 2 (NR4A2)early growth response (EGR)2 and NR4A2EGR3. Therefore, RUNX1, NR4A2, EGR2, EGR3 and ID4 may be key genes associated with the pathogenesis of DS. PMID: 27667480
  15. Our results suggest that NLK inhibits transcriptional activation of Nurr1 gene by impeding CBP's role as a co-activator of NF-kappaB and CREB in prostate cancer. PMID: 27036119
  16. decreased expression levels of Nurr1 were associated with chronic inflammation and insulin resistance in patients with T2D. PMID: 26239742
  17. The immunohistochemical, qRT-PCR and western blot analyses revealed that Nurr1 expression was increased in gastric cancer tissues compared with normal gastric tissue. PMID: 26022133
  18. NR4A2 is a key factor in multiple diseases, such as inflammation, cancer and cardiovascular diseases. PMID: 25917081
  19. A2M is expressed in the vasculature and NR4A receptors modulate VSMC MMP2/9 activity by several mechanisms including the up-regulation of A2M. PMID: 25809189
  20. In this review, a concise overview of the current understanding of the important metabolic roles governed by NR4A members NR4A1, NR4A2 and NR4A3 including their participation in a number of diseases shall be provided PMID: 25089663
  21. Data show that some rexinoids display selective coactivator (CoA) recruitment by the retinoid X receptors (RXRs) homodimer and by the heterodimers nuclear receptor Nur77/RXR and Nurr1/RXR. PMID: 26148973
  22. Thus our data identify a previously unknown role for Nr4a2 in the regulation of macrophage polarization. PMID: 25953901
  23. The results failed to reveal significant link between NR4A2 polymorphism and schizophrenia risk. [META-ANALYSIS] PMID: 25982322
  24. Because the phosphorylation site mutants of NR4A2 cannot rescue the cell death-promoting activity, ASK1-p38 pathway-dependent phosphorylation and subsequent cytoplasmic translocation of NR4A2 may be required for oxidative stress-induced cell death. PMID: 25752609
  25. gestational diabetes mellitus, but not pre-existing maternal obesity, associated with increased placental expression PMID: 25199433
  26. NURR1 upregulation by tissue-type plasminogen activator during ischemic stroke is associated with endothelial dysfunction and inflammation. PMID: 25503547
  27. High cytoplasmic expression of NR4A2 is a potential unfavorable prognostic factor for patients with nasopharyngeal carcinoma. PMID: 23803035
  28. The AngII-NGFIB/NURR1 pathway controls HSD3B1 expression. PMID: 25092869
  29. our data demonstrate that key midbrain dopamine regulators (Nurr1, Pitx3, and Lmx1a) play overlapping as well as distinct roles during neurogenesis and neurotransmitter phenotype determination of mDA neurons PMID: 24172139
  30. The current review describes the role of two such factors, Nurr1 and engrailed, in differentiation, maturation, and in normal physiological functions including acquisition of neurotransmitter identity. PMID: 24685177
  31. Data indicate that expression of Nurr1 was significantly induced by 1,1-bis(3'-indolyl)-1-(p-chlorophenyl methane) (DIM-D). PMID: 23950896
  32. A novel role for the NR4A2 nuclear receptors as direct facilitators of nucleotide excision repair. PMID: 24223135
  33. The results of this study suggest a protective and anti-inflammatory role of NR4A2 and TNFAIP3, both being under-regulated in monocytes and CD4 + T cells of MS patients PMID: 24852325
  34. NR4A2 is regulated by gastrin and influences cellular responses of gastric adenocarcinoma cells. PMID: 24086717
  35. High NR4A2 expression in gastric cancer cells confers chemoresistance, attenuates 5-fluorouracil-induced apoptosis, and predicts an unfavorable survival, especially for those who received chemotherapy. PMID: 23821160
  36. Bioinformatic and deletion studies identified a 5' region of the TSP-1 promoter repressed by NR4A2 and proangiogenic transcription factors, including NF-kappaB and Ets1/2. PMID: 23933487
  37. Nurr1 overexpression significantly increased the SIRT1 occupancy of the consensus elements for Nurr1 binding hTH promoter region. PMID: 23977047
  38. NR4A nuclear receptors are involved in negative selection of thymocytes, Treg differentiation and the development of Ly6C monocytes. Nur77 and Nurr1 attenuate atherosclerosis in mice whereas NOR-1 aggravates vascular lesion formation. PMID: 24005216
  39. High nurr1 is associated with progression of prostate cancer PMID: 23679312
  40. in human melanoma HMV-II cells both CRF and Ucn1 regulate TRP1 gene expression via Nurr-1/Nur77 production, independent of pro-opiomelanocortin or alpha-melanocyte-stimulating hormone stimulation. PMID: 23416839
  41. High expression of NR4A2 in CRC cells confers chemo-resistance, attenuates chemotherapeutics-induced apoptosis, and predicts unfavorable prognosis of colon cancer patients. PMID: 23809767
  42. Recessive genotypes of rs1150143, rs1150144, rs834830, and rs707132 were associated with a worse sustained attention task performance in schizophrenic males, but not females. Males with the GGGTG haplotype had poorer performance. PMID: 22294735
  43. NURR1 function presents a dichotomy in breast cancer etiology, in which NURR1 expression is associated with normal breast epithelial differentiation and efficacy of systemic cancer therapy. PMID: 23517088
  44. PIASgamma fully represses Nurr1 transactivation through a direct interaction, independently of its E3-ligase activity PMID: 23358114
  45. Collectively, our results suggest that NR4A2 may be a susceptibility gene for Parkinson's disease in the Chinese population PMID: 22827504
  46. Nurr1 shuttling between the cytosol and nucleus is controlled by specific nuclear import and export signals PMID: 23283970
  47. Nur-related receptor 1 gene polymorphisms are implicated in alcohol dependence in Mexican Americans PMID: 23066323
  48. Data show altered adipose tissue expression of the NURR1 stress-responsive nuclear receptor in obesity, suggesting it may modulate pathogenic potential in humans. PMID: 22143616
  49. Pin1 enhances the transcriptional activity of all three NR4A nuclear receptors and increases protein stability of Nur77 through inhibition of its ubiquitination. PMID: 22789442
  50. analysis of Nurr1 gene expression in electrically-stimulated human MSCs and the induction of neurogenesis PMID: 22800541

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Note=Mostly nuclear; oxidative stress promotes cytoplasmic localization.
Protein Families
Nuclear hormone receptor family, NR4 subfamily
Tissue Specificity
Expressed in a number of cell lines of T-cell, B-cell and fibroblast origin. Strong expression in brain tissue.
Database Links

HGNC: 7981

OMIM: 601828

KEGG: hsa:4929

STRING: 9606.ENSP00000344479

UniGene: Hs.563344

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*