Recombinant Human P2Y purinoceptor 1 (P2RY1), partial

In Stock
Code CSB-EP017326HU1
Abbreviation Recombinant Human P2RY1 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
(P2Y1)(ADP receptor)(Purinergic receptor)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
326-373aa
Target Protein Sequence
LAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of recombinant Human P2RY1 protein involves manipulating the expression of the desired gene in e.coli cells. The sequence (326-373aa) of foreign DNA is merged with an expression vector and subsequently introduced into e.coli cells. Positive cells are chosen and cultivated to induce the expression of the desired protein. A C-terminal 6xHis tag is fused to the protein. The resulting recombinant Human P2RY1 protein undergoes purification through affinity purification, with a purity exceeding 90%, as confirmed by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for extracellular adenine nucleotides such as ADP. In platelets, binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and ultimately platelet aggregation.
Gene References into Functions
  1. Genomic association study identified deleterious rare variants in P2RY1 in patients with ischemic stroke. PMID: 29232918
  2. Pin1 induces the ADP-induced migration of human dental pulp cells through P2Y1 stabilization. PMID: 27863418
  3. predominant role of P2Y1 receptors in human embryonic stem cells and a transition of P2Y-IP3R coupling in derived cardiovascular progenitor cells are responsible for the differential Ca(2+) mobilization between these cells. PMID: 27098757
  4. The negative feedback modulation between LncRNA-SARCC/AR complex and HIF-2alpha signaling may then lead to differentially modulated RCC progression in a VHL-dependent manner. Together, these results may provide us a new therapeutic approach via targeting this newly identified signal from LncRNA-SARCC to AR-mediated HIF-2alpha/C-MYC signals against RCC progression. PMID: 26973243
  5. these data highlight a key role of the P2Y1/PI3Kbeta axis in endothelial cell proliferation downstream of ecto-F1-ATPase activation by apoA-I. Pharmacological targeting of this pathway could represent a promising approach to enhance vascular endothelial protection. PMID: 28578353
  6. ALIX regulates P2Y1 degradation. PMID: 27301021
  7. There is increased expression of P2Y1 receptors in the rectosigmoid mucosa of diarrhea-predominant irritable bowel syndrome patients. PMID: 27250983
  8. High extracellular NaCl induces priming of the NLRP3 inflammasome in RPE cells, in part via P2Y1 receptor signaling PMID: 27788256
  9. aim of this study was to evaluate the effects of platelet receptor gene (P2Y12, P2Y1) and glycoprotein gene (GPIIIa) polymorphisms, as well as their interactions, on antiplatelet drug responsiveness and clinical outcomes in patients with acute MIS PMID: 28091702
  10. Early neurological deterioration (END) occurred significantly more frequently in patients with aspirin resistance (AR) or high-risk interactive genotypes. Moreover, AR and high-risk interactive genotypes were independently associated with END. PMID: 28068952
  11. Synergistic inhibition of both P2Y1 and P2Y12 adenosine diphosphate receptors by GLS-409 immediately attenuates platelet-mediated thrombosis and effectively blocks agonist-stimulated platelet aggregation irrespective of concomitant aspirin therapy. PMID: 26743169
  12. Antibody EL2Ab binds to and exhibits P2Y1R-dependent function-blocking activity in the context of platelets. PMID: 25593131
  13. P2Y1 couples to and activates TRPV4. PKC inhibitors prevented P2Y1 receptor activation of TRPV4. PMID: 26475857
  14. P2Y1 receptors are a potential pharmacological target leading smooth muscle relaxation to treat spasticity in colonic motor disorders. PMID: 24998877
  15. crystal structures of the human P2Y1R in complex with a nucleotide antagonist MRS2500 at 2.7 A resolution, and with a non-nucleotide antagonist BPTU at 2.2 A resolution PMID: 25822790
  16. Data indicate that ATP-evoked Hoechst 33258 uptake was dependent on activation of P2Y receptors P2Y1 and P2Y2. PMID: 25937122
  17. This study shows that Up4A is a potent native agonist for P2Y1R and SK-channel activation in human and mouse colon. PMID: 25341729
  18. These studies demonstrate a role for P2Y receptor activation in stimulation of ATP release. PMID: 24829920
  19. The immunohistochemical results were reflected in the immunoblotting data P2RY1 receptors were detected at higher levels of expression in patient with cortical dysplasia with intractable epilepsy. PMID: 25003238
  20. P2Y1 and P2Y12 genes were polymorphic in a Korean population; 3 intronic P2Y12 polymorphisms (i-139C>T, i-744T>C, i-801insA) were in complete linkage disequilibrium but not with the c.52C>T polymorphism; platelet aggregation in response to ADP associated with c.52C>T polymorphism but not with the 3 intronic polymorphisms or the P2Y1 c.1622A>T polymorphism PMID: 23849096
  21. We think that allele G provides a protective effect in events of ventilatory stress. Moreover, the significant lack of P2Y1 G allele homozygotes in the SIDS group shows that respiratory response plays an important role in the etiology of SIDS PMID: 23828624
  22. The physiological impact of A87T mutation of the P2Y11 receptor derives from detrimental effects on P2Y1-P2Y11 receptor interaction. PMID: 24524250
  23. Low ATP concentrations potentiated epinephrine-induced platelet aggregation that was abolished by P2Y1 antagonist MRS2500 suggesting P2Y1 receptor activation due to contaminating ADP. PMID: 24071464
  24. H295R, a human adrenal cortex-derived cell line expresses a functional P2Y purinergic receptor for intracellular Ca(2)-mobilization. P2Y is linked to store-operated calcium entry activation, leading to Ca(2)-influx and cortisol secretion. PMID: 23951072
  25. Clopidogrel resistance was not associated with ADP receptor P2Y1 and P2Y12 gene polymorphisms. PMID: 22721490
  26. ATPgammaS induced COX-2 expression and PGE(2) production via a P2 receptor/PKC/NADPH oxidase/ROS/Jak2/STAT3/cPLA(2) signaling pathway in A549 cells. PMID: 23326583
  27. P2Y1 receptors are expressed in intracellular vesicles and sarcolemma of skeletal muscle fibers. PMID: 22052557
  28. Data indicate that single nucleotide polymorphisms (SNPs) in P2RY1 and P2RY12 are associated with on-aspirin platelet reactivity in patients with coronary artery disease (CAD). PMID: 22574824
  29. Data describe a novel function of ARF6 in the internalization of P2Y purinoceptors and demonstrate the integral importance of this small GTPase upon platelet ADP receptor function. PMID: 22916275
  30. Combined blockade of P2Y12, P2Y1 and PI3-kinase p110beta fully prevents platelet and leukocyte activation during hypothermic extracorporeal circulation. PMID: 22701645
  31. Results indicate involvement of P2Y purinoceptors P2Y(1) and P2Y(6) receptors in ADP- and UDP-stimulated proliferation. PMID: 22249129
  32. The role of P2RY1 in individuals from Latvian population is likely to be in platelet aggregation and thromboembolic diseases, and not as a significant contributing factor to the global metabolic syndrome, nor any association with myocardial infarction. PMID: 21643756
  33. functional interaction of A2A and P2Y12 receptors on P2Y1 receptor PMID: 22079667
  34. Activation of the P2Y1 receptor induces apoptosis and inhibits cell proliferation, implying a potentially novel target for prostate cancer. PMID: 21632028
  35. P2Y1 expression plays an important role in ectopic bone formation in the spinal ligaments of patients with ossification of the posterior longitudinal ligament of the spine (OPLL) PMID: 21210088
  36. analysis of a novel Gi, P2Y-independent signaling pathway mediating Akt phosphorylation in response to thrombin receptors PMID: 20586915
  37. Adenosine triphosphate (ATP) acts trophically in brain neurons via its purinergic receptor P2Y1 to regulate gene expression of synaptic transmission and transduction. PMID: 20847060
  38. Evaluation of antiplatelet agents in open flow systems demonstrates that inhibition of either ADP by apyrase or antagonism of P2X(1) signaling had no inhibitory effect on platelet accumulation. PMID: 20473398
  39. These data describe a novel function of SNX1 in the regulation of P2Y(1) receptor recycling and suggest that SNX1 plays multiple roles in endocytic trafficking of G-protein coupled receptors. PMID: 20070609
  40. Data show that ADP significantly increased VEGF, but not endostatin, release from platelets, and that both P2Y(1) and P2Y(12) receptor antagonism inhibited this release. PMID: 20063989
  41. Data show that compound 3 was active in changing intracelluular calcium in 1321N1 human astrocytoma cells stably expressing the hP2Y1 receptor. PMID: 20192270
  42. genetic polymorphisms in ITGA2 and P2RY1 combine with plasma VWF:Ag levels to modulate baseline platelet reactivity in response to collagen plus EPI, while genetic differences in P2RY1 and GP1BA significantly effect platelet responses to collagen plus ADP PMID: 19740098
  43. expression profile in human peripheral tissues and brain regions using PCR PMID: 11690642
  44. Inhibition of platelet P2Y12 and alpha2A receptor signaling by cGMP-dependent protein kinase. PMID: 12147294
  45. immunolocalization of P2Y1 and TPalpha receptors in platelets revealed that while present at the platelet surface, both receptors were abundantly represented inside the platelet - in membranes of alpha-granules and elements of the open-canalicular system PMID: 12393588
  46. Human keratinocytes express multiple P2Y-receptors: evidence for functional P2Y1, P2Y2, and P2Y4 receptors. PMID: 12603858
  47. the P2Y(1) purinoceptor and the P2Y(12)receptor appear to be involved in ADP-induced platelet shape change, an early phase of platelet activation that precedes aggregation PMID: 12623443
  48. Supports P2Y(12) as a drug target compared with P2Y(1). PMID: 14644082
  49. Whereas P2RY1 antagonism did not affect collagen or thrombin-induced thrombin generation, P2RY12 antagonism did decrease both, suggesting that P2RY12, but not P2RY1, is responsible for the potentiation of agonist-induced platelet procoagulant activity. PMID: 15099288
  50. Src kinase is activated through P2Y(1) but not P2Y(12) PMID: 15187029

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 8539

OMIM: 601167

KEGG: hsa:5028

STRING: 9606.ENSP00000304767

UniGene: Hs.654526

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*