Code | CSB-YP339235HUb0 |
Size | US$2010 |
Image |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | PRDX2 |
Uniprot No. | P32119 |
Research Area | Neuroscience |
Alternative Names | Natural killer cell-enhancing factor B |
Species | Homo sapiens (Human) |
Source | Yeast |
Expression Region | 2-198aa |
Target Protein Sequence | ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 24.3kDa |
Protein Length | Full?Length |
Tag Info | N-terminal 10xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). |
Subcellular Location | Cytoplasm |
Protein Families | Peroxiredoxin family, AhpC/Prx1 subfamily |
Database Links |
HGNC: 9353 OMIM: 600538 KEGG: hsa:7001 STRING: 9606.ENSP00000301522 UniGene: Hs.432121 |
Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Protein delta homolog 1(DLK1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Zinc finger protein GLI2(GLI2),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human MARCKS-related protein(MARCKSL1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human C-X-C motif chemokine 10(CXCL10)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Serum amyloid P-component(APCS)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Sulfotransferase family cytosolic 2B member 1(SULT2B1)
Express system: E.coli
Species: Homo sapiens (Human)