Recombinant Human Peroxiredoxin-2(PRDX2)

Code CSB-YP339235HUb0
Product Type Recombinant Protein
Size US$2010
Uniprot No. P32119
Relevance Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Natural killer cell-enhancing factor B
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Research Area Neuroscience
Source Yeast
Gene Names PRDX2
Expression Region 2-198aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 24.3kDa
Protein Description Full?Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).
Subcellular Location Cytoplasm
Protein Families Peroxiredoxin family, AhpC/Prx1 subfamily
Database Links

HGNC: 9353

OMIM: 600538

KEGG: hsa:7001

STRING: 9606.ENSP00000301522

UniGene: Hs.432121

Pathway Cell ageing and metabolism

Related Products

PRDX2 Antibodies

PRDX2 Antibodies for Homo sapiens (Human)

PRDX2 Antibodies for Human

PRDX2 Proteins

PRDX2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.