Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial

In Stock
Code CSB-EP021799HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P51531
Lead Time 3-7 business days
Relevance Transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. Belongs to the neural progenitors-specific chromatin rodeling complex (npBAF complex) and the neuron-specific chromatin rodeling complex (nBAF complex). During neural development a switch from a st/progenitor to a postmitotic chromatin rodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural st/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural st cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias ATP-dependent helicase SMAR;CA2BRG1-associated factor 190B
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF
Research Area Neuroscience
Source E.coli
Gene Names SMARCA2
Expression Region 700-1216aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 75.7kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically
Involvement in disease Nicolaides-Baraitser syndrome (NCBRS); Schizophrenia (SCZD)
Subcellular Location Nucleus
Protein Families SNF2/RAD54 helicase family
Database Links

HGNC: 11098

OMIM: 181500

KEGG: hsa:6595

STRING: 9606.ENSP00000265773

UniGene: Hs.298990

Q&A and Customer Reviews

Q&A
Q:

I am interested in the SMARCA2 Recombinant Protein (CSB-EP021799HU), but have a few questions first:
1.What is the SUMO tag’s length in CSB-EP021799HU?
2.For product, can these tags be cleaved?
3.The MW of SMARCA2 is ~180 kDa. Why is this protein (CSB-EP021799HU) only 76 kDa?

A:
Thanks for your inquiry.
Generally the MW of SUMO-tag on gel is relative larger than the theoretical size. The theoretical size is about 4 kDa. The MW we generally provide is 16 kDa. The tag sequence is as below.

MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSEFRT


We haven't tried to remove the tag from this protein before, so we can't guarantee 100% success.If we fail in removing the tag, we won’t charge for any extra cost.
The full-length protein is 1590aa and the MW is ~180 kDa. The above protein we provide is a fragment with 700-1216aa expression region and the MW is ~59.7 kDa. The target protein sequence is as below.

SYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF


So the MW of the fusion protein is 75.7 kDa (16+59.7=75.7).
Q:

I have aquestion about item CSB-EP021799HU Recombinant human Probable global transcription activator SNF2L2:
Regarding the purification procedures for this protein – is the protein entirely soluble when expressed in the host cell or are denaturation / renaturation protocols used to prepare this protein?
Would you have this information available that you could share?

A:
So nice to receive your inquiry. The product details are confirmed as below.
Code: CSB-EP021799HU
Name: Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial
Expression Region: 700-1216aa; Partial
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Sequence:

SYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF


Product Type: In-stock Recombinant Protein
Inventory Amount: Sufficient
Delivery Form: Liquid
Storage Buffer: 20 mM Tris-HCl,0.5 M NaCl, pH 8.0, 50% glycerol
We conduct soluble expression. The protein is soluble when expressed in the host cell. If you have any further questions, feel free to contact us.
Customer Reviews

Related Products

SMARCA2 Antibodies

SMARCA2 Antibodies for Human

SMARCA2 Antibodies for Homo sapiens (Human)

SMARCA2 Proteins

SMARCA2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.