Name: Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial
Brand: CUSABIO
SKU: CSB-EP021799HU

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	SMARCA2
Uniprot No.	P51531
Research Area	Neuroscience
Alternative Names	ATP-dependent helicase SMAR;CA2BRG1-associated factor 190B
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	700-1216aa
Target Protein Sequence	SYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	75.7kDa
Protein Length	Partial
Tag Info	N-terminal 6xHis-SUMO-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.
Still Have Questions?	Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

■ Q&A

I am interested in the SMARCA2 Recombinant Protein (CSB-EP021799HU), but have a few questions first:
1.What is the SUMO tag’s length in CSB-EP021799HU?
2.For product, can these tags be cleaved?
3.The MW of SMARCA2 is ~180 kDa. Why is this protein (CSB-EP021799HU) only 76 kDa?

Thanks for your inquiry.
Generally the MW of SUMO-tag on gel is relative larger than the theoretical size. The theoretical size is about 4 kDa. The MW we generally provide is 16 kDa. The tag sequence is as below.

MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSEFRT

We haven't tried to remove the tag from this protein before, so we can't guarantee 100% success.If we fail in removing the tag, we won’t charge for any extra cost.
The full-length protein is 1590aa and the MW is ~180 kDa. The above protein we provide is a fragment with 700-1216aa expression region and the MW is ~59.7 kDa. The target protein sequence is as below.

SYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF

So the MW of the fusion protein is 75.7 kDa (16+59.7=75.7).

I have aquestion about item CSB-EP021799HU Recombinant human Probable global transcription activator SNF2L2:
Regarding the purification procedures for this protein – is the protein entirely soluble when expressed in the host cell or are denaturation / renaturation protocols used to prepare this protein?
Would you have this information available that you could share?

So nice to receive your inquiry. The product details are confirmed as below.
Code: CSB-EP021799HU
Name: Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial
Expression Region: 700-1216aa; Partial
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Sequence:

Product Type: In-stock Recombinant Protein
Inventory Amount: Sufficient
Delivery Form: Liquid
Storage Buffer: 20 mM Tris-HCl,0.5 M NaCl, pH 8.0, 50% glycerol
We conduct soluble expression. The protein is soluble when expressed in the host cell. If you have any further questions, feel free to contact us.

■ Customer Reviews

Target Data

Function	Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically
Involvement in disease	Nicolaides-Baraitser syndrome (NCBRS); Schizophrenia (SCZD)
Subcellular Location	Nucleus
Protein Families	SNF2/RAD54 helicase family
Database Links	HGNC: 11098 OMIM: 181500 KEGG: hsa:6595 STRING: 9606.ENSP00000265773 UniGene: Hs.298990

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How did you know this promotion?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial

Product Details

Related Products

Q&A and Customer Reviews

Target Data

Most popular with customers

CloseMessage

×CloseMessage

Code	CSB-EP021799HU
Size	US$1726Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.