Your Good Partner in Biology Research

Tel : 301-363-4651

Home
Protein
Recombinant Protein
Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial

Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial

^{In Stock}

Specification
Target

Code	CSB-EP021799HU
Product Type	Recombinant Protein
Size	US$1726Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.)
Uniprot No.	P51531
Lead Time	3-7 business days
Relevance	Transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. Belongs to the neural progenitors-specific chromatin rodeling complex (npBAF complex) and the neuron-specific chromatin rodeling complex (nBAF complex). During neural development a switch from a st/progenitor to a postmitotic chromatin rodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural st/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural st cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth .
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer	Tris-based buffer,50% glycerol
Alias	ATP-dependent helicase SMAR;CA2BRG1-associated factor 190B
Species	Homo sapiens (Human)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF
Research Area	Neuroscience
Source	E.coli
Gene Names	SMARCA2
Expression Region	700-1216aa
Tag Info	N-terminal 6xHis-SUMO-tagged
Mol. Weight	75.7kDa
Protein Description	Partial
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions?	Leave a Message or Start an on-line Chat

Function	Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically
Involvement in disease	Nicolaides-Baraitser syndrome (NCBRS); Schizophrenia (SCZD)
Subcellular Location	Nucleus
Protein Families	SNF2/RAD54 helicase family
Database Links	HGNC: 11098 OMIM: 181500 KEGG: hsa:6595 STRING: 9606.ENSP00000265773 UniGene: Hs.298990

Q&A and Customer Reviews

Q&A

I am interested in the SMARCA2 Recombinant Protein (CSB-EP021799HU), but have a few questions first:
1.What is the SUMO tag’s length in CSB-EP021799HU?
2.For product, can these tags be cleaved?
3.The MW of SMARCA2 is ~180 kDa. Why is this protein (CSB-EP021799HU) only 76 kDa?

Thanks for your inquiry.
Generally the MW of SUMO-tag on gel is relative larger than the theoretical size. The theoretical size is about 4 kDa. The MW we generally provide is 16 kDa. The tag sequence is as below.

MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSEFRT

We haven't tried to remove the tag from this protein before, so we can't guarantee 100% success.If we fail in removing the tag, we won’t charge for any extra cost.
The full-length protein is 1590aa and the MW is ~180 kDa. The above protein we provide is a fragment with 700-1216aa expression region and the MW is ~59.7 kDa. The target protein sequence is as below.

SYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF

So the MW of the fusion protein is 75.7 kDa (16+59.7=75.7).

I have aquestion about item CSB-EP021799HU Recombinant human Probable global transcription activator SNF2L2:
Regarding the purification procedures for this protein – is the protein entirely soluble when expressed in the host cell or are denaturation / renaturation protocols used to prepare this protein?
Would you have this information available that you could share?

So nice to receive your inquiry. The product details are confirmed as below.
Code: CSB-EP021799HU
Name: Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial
Expression Region: 700-1216aa; Partial
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Sequence:

Product Type: In-stock Recombinant Protein
Inventory Amount: Sufficient
Delivery Form: Liquid
Storage Buffer: 20 mM Tris-HCl,0.5 M NaCl, pH 8.0, 50% glycerol
We conduct soluble expression. The protein is soluble when expressed in the host cell. If you have any further questions, feel free to contact us.

Hide All

Customer Reviews

Submit CUSABIO Product Reciew in 2 Minutes, Win An Apple Watch!

Related Products

SMARCA2 Antibody

SMARCA2 Protein

SMARCA2 Antibodies

SMARCA2 Antibodies for Human

Code	Product Name	Species Reactivity	Application
CSB-PA021799LA01HU	SMARCA2 Antibody	Human	ELISA, IHC, ChIP

SMARCA2 Antibodies for Homo sapiens (Human)

Code	Product Name	Species Reactivity	Application
CSB-PA021799LB01HU	SMARCA2 Antibody, HRP conjugated	Human	ELISA
CSB-PA021799LC01HU	SMARCA2 Antibody, FITC conjugated	Human	ELISA
CSB-PA021799LD01HU	SMARCA2 Antibody, Biotin conjugated	Human	ELISA
CSB-PA004649	SMARCA2 Antibody	Human,Mouse,Rat	WB,ELISA
CSB-PA253060	SMARCA2 Antibody	Human	ELISA,IHC
CSB-PA822578	SMARCA2 Antibody	Human	ELISA,IHC

SMARCA2 Proteins

SMARCA2 Proteins for Homo sapiens (Human)

Code	Product Name	Source
CSB-YP021799HU	Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial	Yeast
CSB-BP021799HU CSB-MP021799HU	Recombinant Human Probable global transcription activator SNF2L2(SMARCA2) ,partial	Baculovirus Mammalian cell

Most popular with customers

Recombinant Human Melanoma antigen preferentially expressed in tumors(PRAME)

Express system: E.coli

Species: Homo sapiens (Human)
Recombinant Human T-complex protein 1 subunit beta(CCT2)

Express system: E.coli

Species: Homo sapiens (Human)
Recombinant Human Integrin alpha-2(ITGA2),partial

Express system: Yeast

Species: Homo sapiens (Human)
Recombinant Mouse Lysosomal acid Glucosylceramidase(Gba)

Express system: Yeast

Species: Mus musculus (Mouse)
Recombinant Human Protein Wnt-5a(WNT5A)

Express system: E.coli

Species: Homo sapiens (Human)
Recombinant Human Pyruvate kinase isozymes R/L(PKLR)

Express system: E.coli

Species: Homo sapiens (Human)
Recombinant Human Vascular endothelial growth factor B(VEGFB)

Express system: Yeast

Species: Homo sapiens (Human)
Recombinant Rat Thyrotropin subunit beta(Tshb)

Express system: Yeast

Species: Rattus norvegicus (Rat)

Product Center

Kit

Protein

Antibody

Molecular Biology Product

Small Molecule

Protein FAQs CUSABIO's Five Expression Systems General Information of Different Tags Production of Recombinant Protein How to Choose A Suitable Expression Vector? How to Express A Protein with Bioactivity? Applications of Recombinant Proteins

Promotions

Products
Service
Technical Resources
Research Tools
About Us
Contact Us
- CUSABIO TECHNOLOGY LLC
- Tel: 301-363-4651
- Email: support@cusabio.com
Join Us with

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How did you know this promotion?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial

Specification

Target