Recombinant Human Prostate stem cell antigen(PSCA)

Code CSB-YP018840HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. O43653
Relevance May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.1 Publication
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Research Area Tags & Cell Markers
Source Yeast
Gene Names PSCA
Protein Names Recommended name: Prostate stem cell antigen
Expression Region 21-95aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 10.2kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
References
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Tissue Specificity Highly expressed in prostate (basal, secretory and neuroendocrine epithelium cells). Also found in bladder (transitional epithelium), placenta (trophoblasts), stomach (neuroendocrine cells), colon (neuroendocrine cells) and kidney (collecting ducts). Over
Database Links

HGNC: 9500

OMIM: 602470

STRING: 9606.ENSP00000301258

UniGene: Hs.652235

Related Products

PSCA Antibodies

PSCA Antibodies for Homo sapiens (Human)

PSCA Antibodies for Human

PSCA Proteins

PSCA Proteins for Homo sapiens (Human)

PSCA ELISA Kit

PSCA ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.