Recombinant Human Prostate stem cell antigen (PSCA), partial

In Stock
Code CSB-EP018840HU1
Abbreviation Recombinant Human PSCA protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
PSCA; UNQ206/PRO232; Prostate stem cell antigen
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
13-86a
Target Protein Sequence
LCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.4 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The formation of the recombinant plasmid by incorporating the gene encoding the Human PSCA protein (13-86aa) into a plasmid vector initiates the generation of the recombinant Human PSCA protein. Transforming the recombinant plasmid into e.coli cells and then selecting the positive e.coli cells based on their ability to survive in the presence of a specific antibiotic. The positive e.coli cells are cultured under conditions that stimulate the expression of the gene of interest. The protein is equipped with a N-terminal 6xHis tag and C-terminal 6xHis tag. After expression, affinity purification is employed to isolate and purify the recombinant Human PSCA protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human PSCA protein, revealing a purity level exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.; May act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits nicotine-induced signaling probably implicating alpha-3:beta-2- or alpha-7-containing nAChRs.
Gene References into Functions
  1. The decreased PSCA m-RNA levels were involved in the progress of bladder cancer. T allele takes more responsibility for PSCA m-RNA down-regulation to promote cell proliferation and migration and hinder cell apoptosis, thus leading to a higher risk. PMID: 29892961
  2. Men with the rs1045531 AC genotype of prostate stem cell antigen(PSCA) were at higher risk of prostate cancer in Chinese patients undergoing prostate biopsy. PMID: 29332451
  3. Study shows that PSCA gene is a target of 8q24 locus in Invasive micropapillary carcinoma (IMPC) of the breast, and the PSCA gene amplification results in PSCA protein overexpression. These results demonstrate an independently worse prognosis for PSCA overexpression in IMPC, and suggest that the differential expression of PSCA is associated with cell adhesion molecules in breast cancer. PMID: 28755148
  4. the PSCA rs2294008 polymorphism may serve as a biomarker of cervical cancer, particularly of early-stage cervical cancer PMID: 27001215
  5. The expression of Ki-67, PSCA, and Cox-2 biomarkers along with other clinicopathologic factors were prognostic factors for biochemical recurrence in patients with clinically localized prostate cancer following radical prostatectomy PMID: 27232854
  6. Among Chinese Han women, the PSCA rs2294008, rs2978974, and rs2976392 minor alleles are associated with increased breast cancer risk especially in progesterone receptor positive breast cancer patients, with breast cancer risk in postmenopausal women, and with high lymph node metastasis risk, respectively. PMID: 27050280
  7. PSCA is a novel cell cycle regulator with a key role in prostate cancer cell proliferation. PMID: 28971496
  8. PSCA regulates IL-6 expression through p38/NF-kappaB signaling in Prostate cancer. PMID: 28845520
  9. the results indicated that the PSCA rs2294008 T and rs2976392 A alleles were low-penetrate risk factors for gastric cancer in this study population. PMID: 26848528
  10. analysis of PSCA level in the peripheral blood of PC patients who underwent radical prostatectomy shows it is related to a GADPH reference level (PSCA/GAPDH ratio) PMID: 26527100
  11. our data provide a novel molecular mechanism for the tumor suppressor role of PSCA PMID: 26785734
  12. suggest that PSCA is a useful tissue marker for predicting biochemical recurrence in patients with high risk PC receiving NHT and radical prostatectomy PMID: 26982980
  13. Genetic Variants of PSCA Gene are not Associated with Colorectal Cancer. PMID: 26320491
  14. we show that PSCA is a key player in nasopharyngeal carcinoma metastasis PMID: 26147638
  15. PSCA rs2294008 Polymorphism is associated with Increased Risk of Cancer PMID: 26308216
  16. PSCA has a promoting role in the growth and metastasis of prostate cancer. PMID: 26477693
  17. PSCA mRNA is overexpressed in the peripheral blood of prostate cancer patients. PMID: 25698533
  18. These results suggest that PSCA gene variation has a potential effect on its expression and gastric adenocarcinoma risk in the Northwest Chinese population. PMID: 26006239
  19. a significantly increased stomach cancer risk was associated with PSCA SNPs rs2294008 and s2976392 in a Han Chinese population. PMID: 25658482
  20. Studied six SNP loci: (rs2279115 of BCL2 gene, rs804270 of NEIL2 gene, rs909253 of LTA gene, rs2294008 of PSCA gene, rs3765524 and rs10509670 of PLCE1 gene) to evaluate gastric cancer risk using magnetic nanoparticles and universal tagged arrays. PMID: 26554163
  21. The PSCA rs2294008 C>T polymorphism may be acting through induction of gastric mucosal atrophy, finally leading to development of gastric ulcer and gastric cancer in PSCA rs2294008 T allele carriers with Helicobacter infections. PMID: 25582162
  22. The PSCA rs2294008 polymorphism is involved in the susceptibility to GC and DU. PMID: 25721731
  23. PSCA signaling may suppress tumor growth in vivo by modulating immunological characteristics of gallbladder cancer cells. PMID: 25964537
  24. In the Han Chinese population, genetic variation in PSCA was significantly correlated with susceptibility to colorectal cancer. PMID: 24557062
  25. rs2294008 polymorphism in the PSCA gene is associated with the risk of bladder cancer. PMID: 25374226
  26. the results suggest that the PSCA rs2294008 (C>T) polymorphism is a risk factor for bladder cancer development. PMID: 25117309
  27. PSCA rs2294008 allele A & T was linked with risk of gastric cancer and high-risk gastritis PMID: 25503145
  28. Accumulating evidence shows an association of PSCA with cancers, such as prostate, gastric, bladder, and pancreatic cancer; however, its expression varies with different cancer types. PMID: 24308679
  29. PSCA is not a marker for a stem cell population nor is it exclusively expressed in the prostate; the function of PSCA in normal cellular processes or carcinogenesis is currently unknown PMID: 24320701
  30. expression of PSCA as a cell surface marker increased from benign prostate tissues and High Grade Prostatic Intraepithelial Neoplasias to prostate cancer PMID: 24183365
  31. PSCA-chimeric antigen receptor T cells may be developed for treatment of prostate cancer. PMID: 24438073
  32. the T allele of rs2294008, an intronic variant of the PSCA gene at 8q24 that was previously associated with an increased risk of gastric cancer, was inversely associated with a decreased risk of esophageal squamous cell carcinoma. PMID: 24654646
  33. Our findings demonstrated that rs2294008 and rs2976392 polymorphism of PSCA is a risk-conferring factor associated with increased gastric cancer susceptibility PMID: 24146278
  34. no clearcut interaction with PSCA SNPs in defining risk of gastric precancerous lesions or cancer PMID: 24023815
  35. Overexpression of PSCA and Oct-4 might be closely related to the carcinogenesis, progression, metastasis, or invasive potential and prognosis of gallbladder carcinoma. PMID: 23984394
  36. Data indicate that PSA, PSMA, hK2, PSCA, DD3, and their combinations, combined analysis of PSA and/or hK2 expression in pelvic lymph nodes could predict biochemical recurrence free survival (BRFS) following radical prostatectomy (RP). PMID: 21600799
  37. A C-allele of rs2294008 at PSCA increased the risk of gastric ulcer. PMID: 23704932
  38. A significant association has been found between the PSCA Trs2294008-Grs2978974 haplotype and higher risk of gallbladder carcinoma in females, whereas this haplotype conferred significantly lower risk to males. PMID: 23988503
  39. Of the 10 target genes, PCA3 and PSCA mRNAs were significantly differently expressed in cancerous tissue than in histologically benign tissue of cancerous prostates PMID: 23391636
  40. Data indicate that RNA silencing of PSCA can inhibit the proliferation and invasiveness properties of prostate cancer PC-3M cells, which may provide a promising therapeutic strategy for prostate cancer. PMID: 21429770
  41. Results indicate the importance of four gastric cancer susceptibility polymorphisms of IL-10, NOC3L, PSCA and MTRR in the Chinese Han population. PMID: 22796266
  42. a genotyping study to assess for associations between the PSCA rs2294008 polymorphism and risk of adenomatous polyps and colorectal cancer PMID: 22824379
  43. study suggested rs2294008 in the PSCA gene to be associated with increased risk of gastric cancer and rs2070803 in MUC1 to play a protective role in a Chinese population PMID: 22938426
  44. findings suggest that the PSCA rs2294008 C>T polymorphism is a risk factor for gastric cancer, especially in diffuse and noncardia gastric cancer and in Chinese PMID: 22938475
  45. The two loci of PSCA (rs2294008 and rs2976392) were both significantly associated with gastric cancer susceptibility and in linkage disequilibrium. PMID: 22426141
  46. intensity of QDs fluorescence remained stable for two weeks (p = 0.083) after conjugation to the PSCA protein, and nearly 93% of positive expression with their fluorescence still could be seen after four weeks PMID: 22778595
  47. Findings suggest that prostate stem cell antigen (PSCA) rs2294008 C > T and rs2976392 G > A polymorphisms may contribute to the susceptibility to gastric cancer, particular in non-cardia or diffused gastric cancer. PMID: 22481254
  48. Associations exist between PSCA SNPs and breast cancer susceptibility in Korean women PMID: 22502712
  49. PSCA is acting as a tumor suppressor in GBC development. PMID: 21936014
  50. The C allele of rs2294008 at PSCA was associated with increased risk of duodenal ulcer in a recessive model but was associated with decreased risk of gastric cancer. PMID: 22387998

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Tissue Specificity
Highly expressed in prostate (basal, secretory and neuroendocrine epithelium cells). Also found in bladder (transitional epithelium), placenta (trophoblasts), stomach (neuroendocrine cells), colon (neuroendocrine cells) and kidney (collecting ducts). Over
Database Links

HGNC: 9500

OMIM: 602470

STRING: 9606.ENSP00000301258

UniGene: Hs.652235

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*