Recombinant Human Pterin-4-alpha-carbinolamine dehydRatase(PCBD1)

Code CSB-YP017514HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P61457
Relevance Involved in tetrahydrobiopterin biosynthesis. Ses to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 4-alpha-hydroxy-tetrahydropterin dehydrataseDimerization cofactor of hepatocyte nuclear factor 1-alpha ;DCoH ;Dimerization cofactor of HNF1;Phenylalanine hydroxylase-stimulating protein;Pterin carbinolamine dehydratase ;PCD
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Research Area Metabolism
Source Yeast
Gene Names PCBD1
Protein Names Recommended name: Pterin-4-alpha-carbinolamine dehydratase Short name= PHS EC= 4.2.1.96 Alternative name(s): 4-alpha-hydroxy-tetrahydropterin dehydratase Dimerization cofactor of hepatocyte nuclear factor 1-alpha Short name=
Expression Region 2-104aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 13.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.
Involvement in disease Hyperphenylalaninemia, BH4-deficient, D (HPABH4D)
Subcellular Location Cytoplasm, Nucleus
Protein Families Pterin-4-alpha-carbinolamine dehydratase family
Database Links

HGNC: 8646

OMIM: 126090

KEGG: hsa:5092

STRING: 9606.ENSP00000299299

UniGene: Hs.3192

Related Products

PCBD1 Antibodies

PCBD1 Antibodies for Homo sapiens (Human)

PCBD1 Antibodies for Human

PCBD1 Proteins

PCBD1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.