Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PCBD1

Uniprot No.

P61457

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

4 alpha hydroxy tetrahydropterin dehydratase; 4-alpha-hydroxy-tetrahydropterin dehydratase; 6 pyruvoyl tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); 6 pyruvoyl tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha; DCoH; Dimerization cofactor of hepatic nuclear factor 1 alpha; Dimerization cofactor of hepatocyte nuclear factor 1 alpha; Dimerization cofactor of hepatocyte nuclear factor 1-alpha; Dimerization cofactor of HNF1; Dimerizing cofactor for HNF1; PCBD 1; PCBD; PCBD1; PCD; Phenylalanine hydroxylase stimulating protein; Phenylalanine hydroxylase-stimulating protein; PHS; PHS_HUMAN; Pterin 4 alpha carbinolamine dehydratase; Pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); Pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha; Pterin carbinolamine dehydratase; Pterin-4-alpha-carbinolamine dehydratase

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-104aa

Target Protein Sequence

AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

15.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Human PCBD1 covers amino acids 2-104. The theoretical molecular weight of the PCBD1 protein is 15.9 kDa. This PCBD1 protein is produced using e.coli expression system. The PCBD1 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant PCBD1 protein in following stages of expression and purification.

Pterin-4-alpha-carbinolamine dehydratase (PCBD1) is a crucial enzyme involved in the biosynthesis of tetrahydrobiopterin (BH4), an essential cofactor for various enzymes, including those participating in neurotransmitter synthesis and nitric oxide production. PCBD1 catalyzes the conversion of 6-pyruvoyl tetrahydropterin to dihydrobiopterin, a key step in the BH4 biosynthetic pathway. Beyond its role in BH4 synthesis, PCBD1 has been associated with various cellular functions, including the regulation of oxidative stress and the modulation of endothelial nitric oxide synthase (eNOS) activity. Additionally, PCBD1 plays a vital role in maintaining redox balance, making it crucial for proper cellular function. Research on PCBD1 focuses on understanding its molecular mechanisms, exploring its interactions with other proteins in the BH4 pathway, and investigating its implications in diseases related to BH4 deficiency or redox imbalance.

Target Background

Function

Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity. Also acts as a coactivator for HNF1B-dependent transcription.

Gene References into Functions

We provide the first genetic evidence that PCBD1 mutations can cause early-onset nonautoimmune diabetes with features similar to dominantly inherited HNF1A-diabetes. PMID: 24848070
Coactivator of the HNFB1 (HNF1 homeobox B)-mediated transcription is necessary for fine tuning ATPase Na+/K+ transporting gamma 1 polypeptide (FXYD2) transcription in the distal convoluted tubule PMID: 24204001
Pcbd1 is a moonlighting protein that has dehydratase activity in addition to functioning as a cofactor which regulates HNF1alpha. PMID: 9092652
variants of the hepatocyte nuclear factor-1beta (HNF-1beta / TCF2) and the dimerization cofactor of HNF-1 (DcoH/PCBD) genes in relation to type 2 diabetes mellitus and beta-cell function PMID: 11668623
Data reveal DCoH/HNF-1 alpha expression and transcriptional activity in human epidermal melanocytes in vitro and in situ and identified tyrosinase, the key enzyme for pigmentation, as a new transcriptional target. PMID: 12565907
Albumin colocalized together with its transcription factor PCD/DCoH/HNF-1alpha in suprabasal keratinocytes in human full-thickness skin sections and in keratinocytes cultured in serum-free medium. PMID: 15740590
Properties of dehydratase/DCoHalpha are consistent with hypothesis that activity of this isozyme could account for relatively mild symptoms reported for patients with a defect in dehydratase/DCoH PMID: 16423549

Hide All

Involvement in disease

Hyperphenylalaninemia, BH4-deficient, D (HPABH4D)

Subcellular Location

Cytoplasm. Nucleus.

Protein Families

Pterin-4-alpha-carbinolamine dehydratase family

Database Links

HGNC: 8646

OMIM: 126090

KEGG: hsa:5092

STRING: 9606.ENSP00000299299

UniGene: Hs.3192

Code	CSB-EP017514HUa0
Abbreviation	Recombinant Human PCBD1 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Pterin-4-alpha-carbinolamine dehydratase (PCBD1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage