Recombinant Human Single Ig IL-1-related receptor (SIGIRR), partial

In Stock
Code CSB-MP743558HU
Abbreviation Recombinant Human SIGIRR protein, partial
MSDS
Size $102
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of Human SIGIRR was greater than 95% as determined by SEC-HPLC.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Single Ig IL-1R-related molecule;Single immunoglobulin domain-containing IL1R-related protein;Toll/interleukin-1 receptor 8 (TIR8)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-118aa
Target Protein Sequence
MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human SIGIRR protein is synthesized through the expression of the target gene encoding the 1-118aa of the human SIGIRR in mammalian cells. The target gene is co-expressed with the C-terminal 6xHis-tag gene via the plasmid. The resulting SIGIRR protein is subjected to affinity chromatography purification, getting a purity exceeding 95% as determined by SDS-PAGE.

The human SIGIRR (TIR8) is a member of the TLR superfamily and regulates immune responses. Structurally, SIGIRR is characterized by a single immunoglobulin (Ig) extracellular domain, a transmembrane domain, and an intracellular Toll/IL-1 receptor (TIR) domain, which is essential for its function as a negative regulator of TLR and interleukin-1 receptor (IL-1R) signaling pathways that modulate inflammatory responses [1][2][3].

SIGIRR is primarily expressed in epithelial tissues, including the kidney, colon, and gastrointestinal tract, where it serves to maintain homeostasis and prevent excessive inflammation [3][4][5]. Its expression is particularly significant in intestinal epithelial cells (IECs), where it regulates the innate immune response by inhibiting the activation of pro-inflammatory signaling pathways such as those mediated by MyD88-dependent signaling [6][7]. This regulatory function is critical in preventing tissue damage and maintaining the balance of immune responses during infections and inflammatory conditions [8][9].

Research has demonstrated that SIGIRR negatively regulates IL-1 signaling by sequestering key signaling molecules such as IRAK and TNF receptor-associated factor (TRAF), from the receptor complex [10][11][12]. This action effectively dampens the recruitment of these components to the receptor, thereby attenuating downstream signaling cascades that lead to inflammation [12][13]. Furthermore, SIGIRR is involved in various pathological conditions, including bacterial infections and Kawasaki disease, where it regulates endothelial apoptosis and inflammation [14][15].

References:
[1] D. Li, X. Zhang, & B. Chen. Sigirr participates in negative regulation of lps response and tolerance in human bladder epithelial cells, BMC Immunology, vol. 16, no. 1, 2015. https://doi.org/10.1186/s12865-015-0137-5
[2] F. Tian, J. Lei, Y. Ni, D. Zhong, N. Xie, J. Ma, et al. Regulation of cd18 stability by sigirr‐modulated ubiquitination: new insights into the relationship between innate immune response and acute lung injury, Febs Journal, vol. 290, no. 10, p. 2721-2743, 2022. https://doi.org/10.1111/febs.16708
[3] F. Tian, Q. Lu, J. Lei, Y. Ni, N. Xie, D. Zhong, et al. Negative effects of sigirr on traf6 ubiquitination in acute lung injury in vitro, Journal of Immunology Research, vol. 2020, p. 1-9, 2020. https://doi.org/10.1155/2020/5097920
[4] M. Watson, D. Costello, D. Carney, K. McQuillan, & M. Lynch. Sigirr modulates the inflammatory response in the brain, Brain Behavior and Immunity, vol. 24, no. 6, p. 985-995, 2010. https://doi.org/10.1016/j.bbi.2010.04.002
[5] X. Chen, Y. Zhao, X. Wu, & G. Qian. Enhanced expression of single immunoglobulin il-1 receptor-related molecule ameliorates lps-induced acute lung injury in mice, Shock, vol. 35, no. 2, p. 198-204, 2011. https://doi.org/10.1097/shk.0b013e3181f226f3
[6] H. Sham, E. Yu, M. Gulen, G. Bhinder, M. Ståhl, J. Chan, et al. Sigirr, a negative regulator of tlr/il-1r signalling promotes microbiota dependent resistance to colonization by enteric bacterial pathogens, Plos Pathogens, vol. 9, no. 8, p. e1003539, 2013. https://doi.org/10.1371/journal.ppat.1003539
[7] J. Allaire, A. Poon, S. Crowley, X. Han, N. Moore, M. Stahl, et al. Interleukin-37 regulates innate immune signaling in human and mouse colonic organoids,, 2020. https://doi.org/10.21203/rs.3.rs-126899/v1
[8] R. Gopal, D. Birdsell, & F. Monroy. Regulation of toll‐like receptors in intestinal epithelial cells by stress and toxoplasma gondii infection, Parasite Immunology, vol. 30, no. 11-12, p. 563-576, 2008. https://doi.org/10.1111/j.1365-3024.2008.01055.x
[9] F. Riva, E. Bonavita, E. Barbati, M. Muzio, A. Mantovani, & C. Garlanda. Tir8/sigirr is an interleukin-1 receptor/toll like receptor family member with regulatory functions in inflammation and immunity, Frontiers in Immunology, vol. 3, 2012. https://doi.org/10.3389/fimmu.2012.00322
[10] M. Gulen, Z. Kang, K. Bulek, Y. Wan, T. Kim, Y. Chen, et al. The receptor sigirr suppresses th17 cell proliferation via inhibition of the interleukin-1 receptor pathway and mtor kinase activation, Immunity, vol. 32, no. 1, p. 54-66, 2010. https://doi.org/10.1016/j.immuni.2009.12.003
[11] T. Bauman, A. Becka, P. Sehgal, W. Huang, & W. Ricke. Sigirr/tir8, an important regulator of tlr4 and il-1r–mediated nf-κb activation, predicts biochemical recurrence after prostatectomy in low-grade prostate carcinomas, Human Pathology, vol. 46, no. 11, p. 1744-1751, 2015. https://doi.org/10.1016/j.humpath.2015.07.015
[12] X. Huang, L. Hazlett, W. Du, & R. Barrett. Sigirr promotes resistance againstpseudomonas aeruginosakeratitis by down-regulating type-1 immunity and il-1r1 and tlr4 signaling, The Journal of Immunology, vol. 177, no. 1, p. 548-556, 2006. https://doi.org/10.4049/jimmunol.177.1.548
[13] M. Khan, T. Steiner, H. Sham, K. Bergstrom, J. Huang, K. Assi, et al. The single igg il-1–related receptor controls tlr responses in differentiated human intestinal epithelial cells, The Journal of Immunology, vol. 184, no. 5, p. 2305-2313, 2010. https://doi.org/10.4049/jimmunol.0900021
[14] Z. Wen, Y. Xia, Y. Zhang, Y. He, C. Niu, R. Wu, et al. Sigirr-caspase-8 signaling mediates endothelial apoptosis in kawasaki disease, Italian Journal of Pediatrics, vol. 49, no. 1, 2023. https://doi.org/10.1186/s13052-022-01401-8
[15] D. Blok, M. Lieshout, A. Hoogendijk, S. Florquin, O. Boer, C. Garlanda, et al. Single Immunoglobulin Interleukin-1 Receptor-Related Molecule Impairs Host Defense during Pneumonia and Sepsis Caused by Streptococcus Pneumoniae, Journal of Innate Immunity, vol. 6, no. 4, p. 542-552, 2014. https://doi.org/10.1159/000358239

c

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

What validations or detections have you performed for this protein SIGIRR?

A:

Normally, we provide molecular weight, electrophoretic results (SDS-PAGE), concentration, purity, etc. For this protein, we have also done HPLC verification. If you have special demand, we can also provide electrophoretic parameters, activity evaluation, sequence identification, tag removal service, endotoxin removal service, WB and MS validations. You can learn more from this link: https://www.cusabio.com/QC_protein.html.

Q:

What is the impact of the tag on any potential biological activity of the SIGIRR protein?

A:

Theoretically small tags generally have very small influence on protein activity. However, the specific impact on protein activity can't be concluded (There is no impact on some proteins, small impact on some proteins, and relatively great impact on some proteins).

Q:

Can you remove the endotoxin?

A:

Not all endotoxin can be removed. Please contact us in advance if you need to remove endotoxin, which takes 2-3 business days. We could offer endotoxin removal service free of charge using PMB affinity chromatography, use LAL reagent to semi-quantitatively detect the content of endotoxin and guarantee endotoxin level within 0.1 ng/μg (1 EU/μg).

Q:

Why is the actual band size different from the predicted one?

A:

a. Post-translational modification. Phosphorylation, glycosylation, etc which increases the size of the protein.
b. Post-translational cleavage. Many proteins are synthesized as pro-proteins, and then cleaved to give the active form.
c. Splice variants. Alternative splicing may create different sized proteins from the same gene.
d. Relative charge. The composition of amino acids have different relative charge which will affect the electrophoretic mobility.
e. Multimers such as dimerization of a protein. This is usually prevented in reducing conditions, although strong interactions can result in the appearance of higher bands.
f. Protein structure such as disulfide bond, protein secondary structure, or protein 3D structure formation.
g. Hydrophobic proteins, such as transmembrane proteins, may have difficulties in migrating into the gel and thus resulting in different multi-banded patterns.

Q:

Can this protein be used in ELISA/WB experiments?

A:

ELISA/WB is mainly aimed at protein immunoreactivity. In theory, this protein is applicable to ELISA/WB experiments, but it is necessary to confirm whether your antibody-antigen information matches, including sequence, expression system, etc., mainly to determine whether the sequence information of the protein (antigen) is consistent with the immunogenic sequence information of the antibody.

Q:

Is this SIGIRR protein cell-component-free?

A:

The protein expressed in the body, regardless of the system, is expressed by cell, and the cell expression can be divided into intracellular expression and secretory expression.
The E. coli system only has intracellular expression and needs to be broken, so the cell components are relatively more secreted than other systems.
Yeast, Baculovirus, and Mammalian cell systems can be expressed both in the cell and in the secretory expression, and the secreted expression of the protein component remains relatively less intracellular.
In vitro expression means that cell-free, and the E. coli cell extract is also added, so that the cell component remains.
Therefore, no matter which expression system and which way the protein is expressed, there will be residual cell components, but we finally use affinity chromatography to purify. In theory, the residual of the cell components will be very small, but 100% of no residue cannot be guaranteed. (Nor does any company dare to guarantee).

Q:

How long can I get the products after I place an order?

A:

We have enough quantity of this protein in stock and can be shipped out in 3-7 business days once passing our Quality Control process. Each of our proteins will undergo a strict QC process before being delivered.

Target Background

Function
Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP.
Gene References into Functions
  1. SIGIRR is both a negative regulator of TLR4 and a positive regulator of TLR7/8. PMID: 28869081
  2. Our results indicate that high IL-1R8 expression acts as a novel immunomodulatory mechanism leading to dysregulated immunity with important implications for breast cancer immunotherapy. PMID: 28533483
  3. show by flow cytometry analysis, western blot, confocal microscopy, and quantitative real-time polymerase chain reaction that IL-1R8 is expressed on human and mouse platelets at high levels and on megakaryocytes. IL-1R8-deficient mice show normal levels of circulating platelets PMID: 27297888
  4. Tir8/SIGIRR acts anti-inflammatory on different immune responses,its function in allergic asthma is a controversial issue, since anti- as well as pro-inflammatory effects have been reported PMID: 26561030
  5. SIGIRR plays an important role in the negative regulation of LPS response and tolerance in human bladder epithelial cells, possibly through its impact on TLR-mediated signaling. PMID: 26634342
  6. Levels of SIGIRR are lower in human colorectal tumors, compared with nontumor tissues; tumors contain the dominant-negative isoform SIGIRR(DeltaE8). PMID: 26344057
  7. SIGIRR predicts biochemical recurrence in patients with low Gleason score and low pathological stage prostate cancer. PMID: 26344417
  8. decreased numbers of SIGIRR-positive CD4+ T cells in SLE patients and its correlation with SLEDAI score as well as the clinical data suggest that SIGIRR may be involved in the pathogenesis of SLE. PMID: 25287661
  9. To the best of our knowledge, this is one of the first reports of a phenotype associated with SIGIRR in humans. Our data provide novel mechanistic insight into the probable causation of necrotizing enterocolitis PMID: 25963006
  10. An association was found in the SIGIRR rs7396562 polymorphism and systemic lupus erythematosus susceptibility in a Chinese population. PMID: 24826913
  11. IL-37 requires the receptors IL-18Ralpha and IL-1R8 to carry out its multifaceted anti-inflammatory program upon innate signal transduction. PMID: 25729923
  12. IL-37 acts as an extracellular cytokine by binding to the IL-18 receptor but using the IL-1R8 for its anti-inflammatory properties. PMID: 25654981
  13. Lipopolysaccharide decreases SIGIRR expression by suppressing specificity protein 1 Sp1 via the TLR4-p38 pathway in monocytes and neutrophils. PMID: 24821721
  14. the tested variations of IRAK-M and SIGIRR genes do not confer a relevant role in the susceptibility to systemic lupus erythematosus in European-descent populations PMID: 22634523
  15. These results demonstrate a strong association of single-nucleotide polymorphisms in the PKP3-SIGIRR-TMEM16J gene region and tuberculosis in discovery and validation cohorts. PMID: 22223854
  16. These results suggest that PALM3 may function as an adaptor in the LPS- Toll-like receptor 4 signaling and the interaction of SIGIRR with PALM3 may partly account for the mechanism of the negatively regulatory effect of SIGIRR. PMID: 21187075
  17. SIGIRR is expressed constitutively in intestinal epithelial cells to maintain gut innate immunity and then down-regulated during inflammation by inhibition of an SP1-mediated pathway. PMID: 21077278
  18. SIGIRR/TIR-8 is an inhibitor of Toll-like receptor signaling in primary human cells and regulates inflammation in models of rheumatoid arthritis PMID: 20506350
  19. regulatory functions in inflammation and Th1/Th2 cell polarization (Review) PMID: 19699681
  20. SIGIRR inhibits IL-1R and TLR4-mediated signaling through different mechanisms PMID: 15866876

Show More

Hide All

Subcellular Location
Membrane; Single-pass type III membrane protein.
Protein Families
Interleukin-1 receptor family
Tissue Specificity
Mainly expressed in epithelial tissues such as kidney, lung and gut.
Database Links

HGNC: 30575

OMIM: 605478

KEGG: hsa:59307

STRING: 9606.ENSP00000333656

UniGene: Hs.501624

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*