| Code | CSB-EP618010HU |
| Size |
$1812Purchase it in Cusabio online store (only available for customers from the US) |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
E.coli-expressed Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4) is a partial-length protein containing 361 amino acids. It carries a 6xHis-tag at the N-terminus. Its expression region is the 74-434aa of the human TEAD4 protein. The SDS-PAGE analysis determined its purity greater than 90% and showed a molecular weight band of about 45 kDa. This protein is in-stock so that it will reach your lab bench faster. In addition to serving as an immunogen for antibody synthesis, the recombinant TEAD4 protein may also be used in the studies of epigenetics and nuclear signaling. TEAD4 is a transcriptional enhancer factor widely expressed in eukaryotic cells. Studies have uncovered that TEAD4 is involved in the multi-level dysregulation and oncogenic characteristics of gastric cancer (GC) and the development of pancreatic cancer. Its transcriptional coactivator Yes-associated protein (YAP) is a major regulator of organ size and proliferation, and increased YAP/TEAD4 activity is correlated to cancer progression and metastasis. Biswarup Saha etc. revealed that the Hippo signaling effector TEAD4 is indispensable for the establishment of pregnancy in a postimplantation mammalian embryo. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | TEAD4 |
| Uniprot No. | Q15561 |
| Research Area | Epigenetics and Nuclear Signaling |
| Alternative Names | EFTR 2; EFTR2; hRTEF 1B; hRTEF1B; MGC9014; OTTHUMP00000238119; OTTHUMP00000238122; OTTHUMP00000238124; Related to TEF 1; Related to TEF1; Related transcription enhancer factor 1B; RTEF1; TCF13L1; TEA domain family member 4; TEAD 4; TEAD-4; TEAD4; TEAD4_HUMAN; TEF 3; TEF3; TEFR 1; TEFR1; Transcription factor 13 (SV40 transcriptional enhancer factor) like 1; Transcription factor 13 like 1; Transcription factor 13-like 1; Transcription factor RTEF 1; Transcription factor RTEF-1; Transcription factor RTEF1; Transcriptional enhancer factor 1 related; Transcriptional enhancer factor 3; Transcriptional enhancer factor TEF 3; Transcriptional enhancer factor TEF-3; Transcriptional enhancer factor TEF3 |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 74-434aa |
| Target Protein Sequence | MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 44.7kDa |
| Protein Length | Partial |
| Tag Info |
N-terminal 6xHis-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif.
|
| Gene References into Functions |
|
| Subcellular Location | Nucleus. |
| Tissue Specificity | Preferentially expressed in skeletal muscle. Lower levels in pancreas, placenta, and heart. |
| Database Links |
HGNC: 11717 OMIM: 601714 KEGG: hsa:7004 STRING: 9606.ENSP00000352926 UniGene: Hs.94865 |
