Recombinant Mouse L-gulonolactone oxidase (Gulo), partial

Code CSB-YP349177MO1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP349177MO1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP349177MO1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP349177MO1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP349177MO1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Gulo
Uniprot No.
Alternative Names
Gulo; L-gulonolactone oxidase; LGO; L-gulono-gamma-lactone oxidase; GLO
Species
Mus musculus (Mouse)
Expression Region
17-187aa
Target Protein Sequence
YGCSPEMYYQPTSVGEVREVLALARQQNKKVKVVGGGHSPSDIACTDGFMIHMGKMNRVL QVDKEKKQVTVEAGILLTDLHPQLDKHGLALSNLGAVSDVTVGGVIGSGTHNTGIKHGIL ATQVVALTLMKADGTVLECSESSNADVFQAARVHLGCLGVILTVTLQCVPQ
Protein Length
partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Oxidizes L-gulono-1,4-lactone to hydrogen peroxide and L-xylo-hexulonolactone which spontaneously isomerizes to L-ascorbate.
Gene References into Functions
  1. Severe vitamin C deficiency is induced in gulo-deficient mice incapable of synthesizing their own ascorbic acid and showing decreased voluntary locomotor activity, diminished physical strength, and increased preference for a palatable sucrose reward. PMID: 23106783
  2. Ascorbate deficiency in Gulo knockout mice leads to an abnormal behavioral phenotype. PMID: 22296218
  3. These data of this study showed a direct relationship between ascorbic acid level and oxidative stress in the gulo(-/-) mice. PMID: 20599829
  4. demonstrated that the sfx mutation involved in spontaneous bone fracture in the murine system is a result of a large deletion in the gene for L-gulonolactone oxidase on mouse Chromosome 14 PMID: 15674730
  5. sfx is a mutation of the GULO gene, which leads to ascorbic acid deficiency, impaired osteoblast cell function, and fractures in affected mice PMID: 16059632
  6. Gulo-deficient mice are cognitively normal but unable to synthesize ascorbic acid; ascorbic acid levels in the brain and liver are higher in Gulo-sufficient mice than in Gulo-low mice. PMID: 18466336
  7. demonstrate here that gene therapeutic HDAd-mCMV-Gulo vectors can mediate the expression of GULO and endogenous production of ascorbic acid in human cells and in Gulo(-/-) transgenic mice PMID: 18764764
  8. Data suggest that through regucalcin and L-gulonolactone oxidase expression, beta-catenin regulates vitamin C biosynthesis in liver. PMID: 19690176

Show More

Hide All

Subcellular Location
Microsome membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
Protein Families
Oxygen-dependent FAD-linked oxidoreductase family
Tissue Specificity
Highly expressed in liver.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1