Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP338557MOe1 |
| Product Type | Recombinant Protein |
| Size |
US$2632Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | P23953 |
| Lead Time | 3-7 business days |
| Relevance | Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Liver carboxylesterase N Lung surfactant convertase PES-N |
| Species | Mus musculus (Mouse) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH |
| Research Area | others |
| Source | E.coli |
| Gene Names | Ces1c |
| Expression Region | 19-550aa |
| Tag Info | Tag-Free |
| Mol. Weight | 58.6kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant. |
| Subcellular Location | Endoplasmic reticulum lumen |
| Protein Families | Type-B carboxylesterase/lipase family |
| Tissue Specificity | Expressed in lung, kidney and liver. |
| Database Links |
KEGG: mmu:13884 STRING: 10090.ENSMUSP00000034189 UniGene: Mm.88078 |
Ces1c Antibodies for Mouse
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA338557YC01MO | Ces1c Antibody, FITC conjugated | Mouse | ELISA |
| CSB-PA338557YA01MO | Ces1c Antibody | Mouse, Human, Rat | ELISA, WB, IHC |
| CSB-PA338557YD01MO | Ces1c Antibody, Biotin conjugated | Mouse, Rat | ELISA, WB |
| CSB-PA338557YB01MO | Ces1c Antibody, HRP conjugated | Mouse | ELISA |
Ces1c Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP338557MO | Recombinant Mouse Carboxylesterase 1C(Ces1c),partial | E.coli |
| CSB-YP338557MO | Recombinant Mouse Carboxylesterase 1C(Ces1c),partial | Yeast |
| CSB-BP338557MO CSB-MP338557MO |
Recombinant Mouse Carboxylesterase 1C(Ces1c) | Baculovirus Mammalian cell |
Recombinant Sheep Tumor necrosis factor(TNF),partial,partial
Express system: Yeast
Species: Ovis aries (Sheep)
Recombinant Human Proteasome subunit beta type-3(PSMB3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Complement C1q subcomponent subunit A(C1QA)
Express system: Baculovirus
Species: Homo sapiens (Human)
Recombinant Human Glutathione peroxidase 1(GPX1)
Express system: E.coli
Species: Homo sapiens (Human)
