Recombinant Mouse Carboxylesterase 1C (Ces1c), partial

In Stock
Code CSB-EP338557MOe1
Abbreviation Recombinant Mouse Ces1c protein, partial
MSDS
Size US$472
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Ces1c
Uniprot No.
Research Area
others
Alternative Names
Carboxylesterase 1C; Ces N; Ces1c; Ee 1; Ee 4; Ee1; Es N; Es1; Es4; EsN; EST1C_MOUSE; Esterase 1; Liver carboxylesterase N; Lung surfactant convertase; PES-N; PESN
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
19-550aa
Target Protein Sequence
HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
58.6kDa
Protein Length
Partial
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The process of producing recombinant mouse Carboxylesterase 1C (Ces1c) involves several key steps. First, the target gene coding for the 19-550aa of the mouse Ces1c is obtained. This gene is cloned into an expression vector, designed to carry the gene into a host cell. The vector is transformed into E. coli cells, where the recombinant protein is expressed. The protein is collected from the cell lysate and purified using affinity chromatography. Finally, the recombinant Ces1c protein's purity is measured by SDS-PAGE, reaching up to 90%.

Mouse Ces1c is an enzyme found in mice that plays a crucial role in the metabolism and stability of various compounds, particularly linkers in drug delivery systems. This enzyme, absent in humans, monkeys, and dogs, has been identified as responsible for the rapid degradation of certain linkers in mouse plasma, impacting the pharmacokinetics of drugs [1][2]. Studies have highlighted the significance of Ces1c in cleaving linkers such as valine-citrulline-paminocarbamate (VC-PABC) in mouse plasma, leading to linker instability [3][4]. Ces1c has been associated with the hydrolysis of linkers like Val-containing peptide linkers in mouse plasma, affecting the stability of drug conjugates [5][6]. Furthermore, Ces1c has been linked to the instability of specific linkers in mouse plasma, complicating the interpretation of pharmacokinetic and pharmacodynamic studies in mice [7]. The presence of Ces1c in mice has been shown to influence the stability and efficacy of drug delivery systems, particularly antibody-drug conjugates (ADCs), by cleaving susceptible linkers like Val-Cit in mouse plasma [8][9].

References:
[1] W. Zhang, Pharmacokinetics of panobinostat: interspecies difference in metabolic stability, Journal of Pharmacology and Experimental Therapeutics, vol. 389, no. 1, p. 96-105, 2024. https://doi.org/10.1124/jpet.123.002051
[2] R. Ubink, E. Dirksen, M. Rouwette, E. Bos, I. Janssen, D. Egginget al., Unraveling the interaction between carboxylesterase 1c and the antibody–drug conjugate syd985: improved translational pk/pd by using ces1c knockout mice, Molecular Cancer Therapeutics, vol. 17, no. 11, p. 2389-2398, 2018. https://doi.org/10.1158/1535-7163.mct-18-0329
[3] M. Dorywalska, R. Dushin, L. Moine, S. Farias, D. Zhou, T. Navaratnamet al., Molecular basis of valine-citrulline-pabc linker instability in site-specific adcs and its mitigation by linker design, Molecular Cancer Therapeutics, vol. 15, no. 5, p. 958-970, 2016. https://doi.org/10.1158/1535-7163.mct-15-1004
[4] M. Dorywalska, Data from molecular basis of valine-citrulline-pabc linker instability in site-specific adcs and its mitigation by linker design,, 2023. https://doi.org/10.1158/1535-7163.c.6538915
[5] Z. Su, D. Xiao, F. Xie, L. Liu, Y. Wang, S. Fanet al., Antibody–drug conjugates: recent advances in linker chemistry, Acta Pharmaceutica Sinica B, vol. 11, no. 12, p. 3889-3907, 2021. https://doi.org/10.1016/j.apsb.2021.03.042
[6] A. Pal, W. Albusairi, F. Liu, M. Tuhin, M. Miller, D. Lianget al., Hydrophilic small molecules that harness transthyretin to enhance the safety and efficacy of targeted chemotherapeutic agents, Molecular Pharmaceutics, vol. 16, no. 7, p. 3237-3252, 2019. https://doi.org/10.1021/acs.molpharmaceut.9b00432
[7] N. Loos, Interplay of ritonavir-boosted oral cabazitaxel with the organic anion-transporting polypeptide (oatp) uptake transporters and carboxylesterase 1 in mice, Molecular Pharmaceutics, vol. 21, no. 4, p. 1952-1964, 2024. https://doi.org/10.1021/acs.molpharmaceut.3c01205
[8] S. Seaman, Z. Zhu, S. Saha, X. Zhang, M. Yang, M. Hiltonet al., Eradication of tumors through simultaneous ablation of cd276/b7-h3-positive tumor cells and tumor vasculature, Cancer Cell, vol. 31, no. 4, p. 501-515.e8, 2017. https://doi.org/10.1016/j.ccell.2017.03.005
[9] N. Ashman, J. Bargh, & D. Spring, Non-internalising antibody–drug conjugates, Chemical Society Reviews, vol. 51, no. 22, p. 9182-9202, 2022. https://doi.org/10.1039/d2cs00446a

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.
Gene References into Functions
  1. Phospho-non-steroidal anti-inflammatory drugs hydrolysis in wild-type mouse plasma was 6-530-fold higher than that in the plasma of Ces1c-/- mice. PMID: 25392229
  2. Hepatic carboxylesterase 1 is induced by glucose and regulates postprandial glucose levels PMID: 25285996
  3. These results identify and characterize ES1 as a novel transcriptional regulator of GHR gene expression. PMID: 21659478
Subcellular Location
Endoplasmic reticulum lumen. Note=Microsomal membrane, lumen of endoplasmic reticulum.
Protein Families
Type-B carboxylesterase/lipase family
Tissue Specificity
Expressed in lung, kidney and liver.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*