Name: Recombinant Mouse Carboxylesterase 1C (Ces1c), partial
Brand: CUSABIO
SKU: CSB-YP338557MO

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.

Target Names

Ces1c

Uniprot No.

P23953

Research Area

Others

Alternative Names

Carboxylesterase 1C; Ces N; Ces1c; Ee 1; Ee 4; Ee1; Es N; Es1; Es4; EsN; EST1C_MOUSE; Esterase 1; Liver carboxylesterase N; Lung surfactant convertase; PES-N; PESN

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

19-550aa

Target Protein Sequence

HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

60.6kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Regarding your protein CSB-YP338557MO, could you please advise where or not this is one of the proteins that you have received feedback for as being enzymatically active?

Very nice to receive your inquiry. We previously received some customer feedback about the enzyme activity of this protein, and this protein is also one of the best-selling proteins, which has been ordered many times by other customers, we have both of the liquid and lyophilized form in stock.
Recombinant Mouse Carboxylesterase 1C(Ces1c), partial
CSB-YP338557MO >> Yeast
Expression Region: 19-550aa; Partial.
Tag information:N-terminal 6xHis-tagged.
Sequence:

Target Background

Function

Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.

Gene References into Functions

Phospho-non-steroidal anti-inflammatory drugs hydrolysis in wild-type mouse plasma was 6-530-fold higher than that in the plasma of Ces1c-/- mice. PMID: 25392229
Hepatic carboxylesterase 1 is induced by glucose and regulates postprandial glucose levels PMID: 25285996
These results identify and characterize ES1 as a novel transcriptional regulator of GHR gene expression. PMID: 21659478

Subcellular Location

Endoplasmic reticulum lumen. Note=Microsomal membrane, lumen of endoplasmic reticulum.

Protein Families

Type-B carboxylesterase/lipase family

Tissue Specificity

Expressed in lung, kidney and liver.

Database Links

KEGG: mmu:13884

STRING: 10090.ENSMUSP00000034189

UniGene: Mm.88078

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-YP338557MO
Abbreviation	Recombinant Mouse Ces1c protein, partial
MSDS	MSDS Datasheet
Size	$368
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP338557MO could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ces1c. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP338557MO could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ces1c. The purity of Ces1c was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Carboxylesterase 1C (Ces1c), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage